PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29706.m001281
Common NameLOC8284651, RCOM_0652460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 548aa    MW: 60960.7 Da    PI: 6.2352
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29706.m001281genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS262.81.2e-801645402374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                    ++lL  cA avs+g+l+++q+lL  l+elas++gd+++Rla+y ++AL ++l++  s++++++ + + ++ + +    +l  f+evsP++ f + +
  29706.m001281 164 EDLLNPCAAAVSTGNLSRVQHLLYVLHELASSTGDANHRLAFYGLQALTHHLSS--SRTSASIGSVSFTSIDPKFFQRSLLKFYEVSPWFAFPNNI 257
                    57999************************************************9..88888888888885555555555555************** PP

           GRAS  98 aNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfefn 179
                    aN+ Il+ +++e    + +Hi+D+++s+G+QWp+Ll+aL+ R+ ++pp +RiT++ +  ++               +  +rL +fA++l++++++n
  29706.m001281 258 ANSSILQVLAQEldhkRNLHILDIGVSHGVQWPTLLEALTRRSgGPPPLVRITVITATVESdqntetpfsVGPPGDNFSSRLLNFAKSLNINLQIN 353
                    *******999999887899************************55666******9986665666677776666778999***************** PP

           GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..nsesFlerflealeyysalfdsl.e 272
                     l  + l++l+ + ++++p+++l+V+ +++lh+l    ++ ++er+e+Lk+++sl+Pk v+++e+++d+    ++F+++f++ ++y ++++ds+ +
  29706.m001281 354 RLDNHPLQSLNAQVINTNPEDTLVVCAQFRLHHLN---HNNPDERTEFLKVLRSLEPKGVILSENNTDRcqICGDFATGFSRRVDYLWKFLDSTsS 446
                    *9999*****************************8...67777789*********************9954457********************66 PP

           GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpL 367
                    a  +reseer+++E e    +++ ++ c + +       +ekW er++++GF    ++e++ + a++llrk++ ++++r ee++g++ l Wk++p+
  29706.m001281 447 AFKGRESEERRVMEGE----AAKALINCGEMN-----DGKEKWCERMRDSGFVGEVFGEDTIDGARALLRKYDsNWEMRTEEKDGCVGLWWKGQPV 533
                    6666777888887766....677777777766.....899*********************************9999******************* PP

           GRAS 368 vsvSaWr 374
                     ++S Wr
  29706.m001281 534 SFCSLWR 540
                    ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.71137519IPR005202Transcription factor GRAS
PfamPF035144.2E-78164540IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MTIGEPEPNH ISDHILDWLE DSVSFLPSFL DDPYNSGGIS NYQWWNQTEG ICQDPINSNT  60
SLSSSSTITA NTNTTSPLAT NDHTIDHQPP SNSTSKREAP DDPVPKASQN HHQRKKQNTR  120
ISNEGDQGVE VMIGKRSNGN KKSASKGAAN NANSGNNKEG RWAEDLLNPC AAAVSTGNLS  180
RVQHLLYVLH ELASSTGDAN HRLAFYGLQA LTHHLSSSRT SASIGSVSFT SIDPKFFQRS  240
LLKFYEVSPW FAFPNNIANS SILQVLAQEL DHKRNLHILD IGVSHGVQWP TLLEALTRRS  300
GGPPPLVRIT VITATVESDQ NTETPFSVGP PGDNFSSRLL NFAKSLNINL QINRLDNHPL  360
QSLNAQVINT NPEDTLVVCA QFRLHHLNHN NPDERTEFLK VLRSLEPKGV ILSENNTDRC  420
QICGDFATGF SRRVDYLWKF LDSTSSAFKG RESEERRVME GEAAKALINC GEMNDGKEKW  480
CERMRDSGFV GEVFGEDTID GARALLRKYD SNWEMRTEEK DGCVGLWWKG QPVSFCSLWR  540
LDMKGNDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-3916054084473Protein SHORT-ROOT
5b3h_B8e-4016054030419Protein SHORT-ROOT
5b3h_E8e-4016054030419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29706.m001281
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002521327.10.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLB9S5Q80.0B9S5Q8_RICCO; Nodulation signaling pathway 1 protein, putative
STRINGXP_002521327.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-173GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]