PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29700.m000761
Common NameRCOM_0641740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRF
Protein Properties Length: 479aa    MW: 51080.8 Da    PI: 7.0998
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29700.m000761genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.5e-24145187244
            WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     epgrCrRtDGKkWRCsr++ +++k+CErH+hrgr rsrk++e
  29700.m000761 145 LEPGRCRRTDGKKWRCSRDAAPDQKYCERHMHRGRPRSRKPVE 187
                    69**************************************986 PP

2QLQ55.31.9e-1980112234
            QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                    +FT aQ+ +L++Q+++yKy++a++PvPp+Ll++
  29700.m000761  80 PFTIAQWKELERQAMIYKYMMASVPVPPHLLLP 112
                    8******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.2E-1279115IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.9E-1480112IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.88480115IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.811144188IPR014977WRC domain
PfamPF088791.1E-20146187IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MRSRIKCNPS GDTYYYSVAA GGSGTAAAAT YYGAAVDSVS AARTLQPFDT SPTEAVITAT  60
VFKSPDMKMA ATAAPSLEFP FTIAQWKELE RQAMIYKYMM ASVPVPPHLL LPTSRNLHSD  120
PAAAASLSSL GSGGLNLKYT NGADLEPGRC RRTDGKKWRC SRDAAPDQKY CERHMHRGRP  180
RSRKPVELLA NTNNNKKIRY NYVNNHTNSA QSPVAWAVAN KNGAADSQFL GSIAQPYVQA  240
PVFLDKPSTK VADFDGSMAF ASNFKESRSL QWMMKGEAAS IATADQQWPG IGLSSDCSFN  300
PEYQREALNL NSFGDFSAGE DQRNNQSRGF IDAWSNVASD KQSDNSGNTN SSFTSSGLLS  360
LGINSINDEM SQIQMGLGLV ESDQNHGSSI KPLALAPAAW PEGATVSPGG PLAEVLQLSS  420
GNTVVENGDP TSPPATAASS PSGVLQRTLA SFSDSSANSS PTLGSSVRDK SEIALMWLN
Cis-element ? help Back to Top
SourceLink
PlantRegMap29700.m000761
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002521932.20.0growth-regulating factor 7
TrEMBLB9S7G30.0B9S7G3_RICCO; Uncharacterized protein
STRINGXP_002521932.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.16e-36growth-regulating factor 2