PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29693.m002042
Common NameLOC8264143, RCOM_0633680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 220aa    MW: 25098.6 Da    PI: 9.8262
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29693.m002042genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.22.4e-191662147
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                   krien+  r +tfskRr gi KKA+EL +LC+aev +++fs+ gk +
  29693.m002042 16 KRIENEEDRLITFSKRRSGIYKKASELITLCGAEVGILVFSPAGKPF 62
                   79*****************************************9855 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.9E-28867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.726868IPR002100Transcription factor, MADS-box
CDDcd002653.62E-31977No hitNo description
SuperFamilySSF554554.71E-26983IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-191030IPR002100Transcription factor, MADS-box
PfamPF003194.4E-231764IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-193045IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-194566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MAGKKQTKGR QKITMKRIEN EEDRLITFSK RRSGIYKKAS ELITLCGAEV GILVFSPAGK  60
PFSFGHPSLE SIANRFLGKN VPPSDNTHPL VEAHRKMRIN ELNKQYNELL NRLESEKERG  120
SMLKKTIRGK GCNNWWEAPI DDLNMQELEQ IYAMFEELHS TLCKKMNEKR NNGVSIWSSS  180
IPQMNNHGLM VNNSSAYNIP NNENHFSSFH HGCGFGQGQF
Cis-element ? help Back to Top
SourceLink
PlantRegMap29693.m002042
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519715.11e-164agamous-like MADS-box protein AGL61
TrEMBLB9S1461e-163B9S146_RICCO; Mads box protein, putative
STRINGXP_002519715.11e-164(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.15e-44AGAMOUS-like 61