PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29693.m002041
Common NameLOC8264142, RCOM_0633570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 239aa    MW: 26512 Da    PI: 9.9072
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29693.m002041genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.53.1e-171967149
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   k+ien+  r +tfskRr gi KKA+EL +L++ae a +++s+ gk + +
  29693.m002041 19 KKIENEDDRLITFSKRRSGIYKKASELVTLTGAELAFLVYSPAGKPFSF 67
                   68******************************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.5771171IPR002100Transcription factor, MADS-box
SMARTSM004324.5E-261170IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.85E-251297IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-171333IPR002100Transcription factor, MADS-box
PfamPF003197.4E-212067IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-173348IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-174869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MAGDNQGKKT KGRQKIEMKK IENEDDRLIT FSKRRSGIYK KASELVTLTG AELAFLVYSP  60
AGKPFSFAHP SMDAITNRFF GQGSADRNNN PTTHPLIEAH RLMRIEELNQ QHNELLRQLE  120
IEKEKGKQLK QKHKKNNERK GWWDTPIEEL NVPELLQMEA ACKEIRTSLI NKLKEKTNNG  180
ASSAAAAAGG VGGVAIAGHP PTTDHYSAHM INPFASTVAI NPNNPSVFTP GFDYGHGQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1hbx_A3e-14268167SERUM RESPONSE FACTOR
1hbx_B3e-14268167SERUM RESPONSE FACTOR
1hbx_D3e-14268167SERUM RESPONSE FACTOR
1hbx_E3e-14268167SERUM RESPONSE FACTOR
1srs_A3e-14268167PROTEIN (SERUM RESPONSE FACTOR (SRF))
1srs_B3e-14268167PROTEIN (SERUM RESPONSE FACTOR (SRF))
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap29693.m002041
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519714.11e-179agamous-like MADS-box protein AGL62
TrEMBLB9S1451e-178B9S145_RICCO; Mads box protein, putative
STRINGXP_002519714.11e-179(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04100.16e-36AGAMOUS-like 57