PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29693.m002039
Common NameLOC8264140, RCOM_0633450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 172aa    MW: 19737.9 Da    PI: 10.5606
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29693.m002039genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.71.1e-211053245
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    ++++s rqvtfskRr+g++KKA+EL +LC+a++a+++fs+ gk
  29693.m002039 10 MVKDTSSRQVTFSKRRTGLFKKANELATLCAAQIAIVVFSPGGK 53
                   67999************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.8E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.114161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.24E-27174IPR002100Transcription factor, MADS-box
CDDcd002651.90E-31271No hitNo description
PRINTSPR004044.4E-20323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGRRKIEMKM VKDTSSRQVT FSKRRTGLFK KANELATLCA AQIAIVVFSP GGKPFSFGHP  60
TVQSVAERFL NQDLNKKPRV SFQEARLEKL NKQLNDVQKQ LQYEKKKEAF LNKALKASGI  120
PKYDEMSADE LLNFKKALEE LREKMKARVV EMEASSSLLL LSEKQNQENR DQ
Cis-element ? help Back to Top
SourceLink
PlantRegMap29693.m002039
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519712.11e-122agamous-like MADS-box protein AGL29
TrEMBLB9S1431e-121B9S143_RICCO; Mads box protein, putative
STRINGXP_002519712.11e-122(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-41AGAMOUS-like 29