PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29683.m000467
Common NameLOC8265938, RCOM_0615030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family NAC
Protein Properties Length: 192aa    MW: 22202.9 Da    PI: 4.735
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29683.m000467genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM118.56.6e-3791271128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrF Pt+eelvv++L++k++  +++  +vi+++d+y ++Pw+L+ k+ ae ++wy++s+r         +nr+t++gyWka g d++vl++ 
  29683.m000467   9 LPPGFRFYPTEEELVVHFLQRKAALLPCHP-DVIPDLDLYPYDPWELDGKALAEGRQWYYYSRRT--------QNRITENGYWKAIGIDEPVLTNA 95 
                    79*************************999.99**************977778899******984........58********************* PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++ vg+kk   fy g+ap g kt+W+m+eyrl
  29683.m000467  96 NKRVGIKKYSLFYVGEAPGGMKTNWIMEEYRL 127
                    ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-475159IPR003441NAC domain
PROSITE profilePS5100544.8219160IPR003441NAC domain
PfamPF023652.2E-2010127IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSGNNNVNLP PGFRFYPTEE ELVVHFLQRK AALLPCHPDV IPDLDLYPYD PWELDGKALA  60
EGRQWYYYSR RTQNRITENG YWKAIGIDEP VLTNANKRVG IKKYSLFYVG EAPGGMKTNW  120
IMEEYRLSSS DCPSSSRSSK RRGHPKIDYS KWVICKVYER NCDDEDDGST ELSCLDEVFL  180
SLEDMEEISL PN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-43516513170NO APICAL MERISTEM PROTEIN
1ut4_B2e-43516513170NO APICAL MERISTEM PROTEIN
1ut7_A2e-43516513170NO APICAL MERISTEM PROTEIN
1ut7_B2e-43516513170NO APICAL MERISTEM PROTEIN
4dul_A2e-43516513170NAC domain-containing protein 19
4dul_B2e-43516513170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29683.m000467
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002528415.11e-142NAC domain-containing protein 104 isoform X1
SwissprotQ8GWK61e-82NC104_ARATH; NAC domain-containing protein 104
TrEMBLB9SQZ61e-141B9SQZ6_RICCO; NAC domain-containing protein, putative
STRINGXP_002528415.11e-142(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.14e-83xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]