PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29647.m001998
Common NameRCOM_0555290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family HB-other
Protein Properties Length: 1021aa    MW: 113580 Da    PI: 9.7466
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29647.m001998genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.54.8e-0865121157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                    +r+R  ++++ ++ ++++F ++  +s++e +e++++ g+t +qV+ +F  +R + +k
  29647.m001998  65 KRPRDLLNPKAIKYMQAVFSMKDAISKKECREISAQFGVTVTQVRDFFNSQRSRVRK 121
                    799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-760116IPR009057Homeodomain-like
PROSITE profilePS5007110.07462122IPR001356Homeobox domain
SMARTSM003895.7E-564126IPR001356Homeobox domain
SuperFamilySSF466891.15E-665125IPR009057Homeodomain-like
CDDcd000861.28E-565121No hitNo description
PfamPF000461.7E-565121IPR001356Homeobox domain
Gene3DG3DSA:1.20.930.102.0E-6224317IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476763.4E-6225317IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1021 aa     Download sequence    Send to blast
MENLEEIEIG TSVVSFQKIL DSQKELFHCQ IDQLQRIVVT QCKLTGVNPL SQEMAAGAMS  60
IKIGKRPRDL LNPKAIKYMQ AVFSMKDAIS KKECREISAQ FGVTVTQVRD FFNSQRSRVR  120
KLVRLSREKV ARANSYDERQ DGVPTSSDPM VPIDMAPLNS VYPDLVNFVG SNPAPLSSVD  180
DILPGLHDQD RHFVENIFNL LRKEETFSGQ VKLMEWILQI QNPSVLNWFL TKGGVMILAT  240
WLSQAAAEEQ TSMLLVTLKV LCHLPLHKAV PEHMSAILHS VNRLRFYRTS DISNRARVLL  300
SRWSKMFARA QAMKKPNGMK SSMDPQEMIL KQSIDEIMGN ELWHPNGNNL EDVLALSESS  360
ENMRKMEPSQ TLKLLPAPTD DSSRKHILGV LSSHTRERRK VQLVEQPGQK TGGRGPQATK  420
AAPASQGRPM STDDIQKAKM RALFMQSKQG KTVSSSNGIN GMKKGGLSKL SSALSGNLSS  480
SSEVPLLPKV EETKKSVVAP QKNFKQEGPL DPIRKMDLKE PLEDLCKRVR IPWQTPPEIK  540
LNDLWRVGNG ENSKEVDVQK NRNRREIEII YRTVQDIPAN PKAPWDVEMD YDDTLTPEIP  600
IEQPPDADVA ETQVIPNEKI VNTVVTPAPT LPQINGGSAA EPDLELLAVL LKNPELVFAL  660
TSGHAGNISP QDTVKLLDMI KRSGTGLADS VNVFGGKVEE KVEVSLPSPT PSSNPGTAGW  720
RPQVVKNPFS QQNSRGKRVA YSDRPVPTTI PSMQPQNLDS NIKIPQQQAT ASPQSLSQQV  780
QSAIPRFSLP QTTSSSYIHE NQQLSMIFPS HQSLPTNSSM LHTKASEMGL PMNTPHARNF  840
LAGSSVRVET VNHVQPAQSV SYAMNTPERQ PVSSPLPPSL PITTRAHPQT HLVSDPVHVH  900
QSTGNMGSMP ESWRSRQLVA SNSVSQVNQT NYDASSFRGP AQPQVRPGPP WERNEYMGND  960
GFESWSPENS PSRSPEYMPG RNYPGPGTNP GWNYNPDNRA RQRDYNSGHR DQTRNGNRRW  1020
R
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29647.m001998
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015575659.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLB9S3T80.0B9S3T8_RICCO; Homeobox protein LUMINIDEPENDENS, putative
STRINGXP_002520657.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-180HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]