PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29646.m001108
Common NameLOC8264231, RCOM_0554250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 325aa    MW: 36305.1 Da    PI: 6.9671
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29646.m001108genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1331.3e-10198241548
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                    kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  29646.m001108 198 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 241
                    8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-13194258IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622196248IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.26E-11198252No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-11198249No hitNo description
PfamPF001702.8E-9198241IPR004827Basic-leucine zipper domain
CDDcd147031.09E-22199249No hitNo description
PROSITE patternPS000360201216IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MAQLPPKIPN MQPTWPEFSH HQKLPSMGII APSNNNAAAS TAAAAATTTQ NPSWVDEFLD  60
FSSARRGTHR RSVSDSIAFL EAPLIEECRA IGAPHHHHHH HHGSGHNSSS DFDKFDDEQF  120
MSMFNDDISN AVAPSCSNPS TPSDHNSFND EKEPTLSDQK QQKIRNESDE VQSQCQTDTQ  180
NPSNATNTTS SDRIIDPKRV KRILANRQSA QRSRVRKLQY ISELERSVTS LQAEVSVLSP  240
RVAFLDHQRL LLNVDNSALK QRIAALAQDK IFKDAHQEAL KREIERLRQV YHQQNLKNME  300
NATASPSPAT DSTAPTEKGQ QLLQV
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29646.m001108
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525146.10.0basic leucine zipper 61
SwissprotQ9M2K41e-121BZP61_ARATH; Basic leucine zipper 61
TrEMBLB9SGM70.0B9SGM7_RICCO; Transcription factor RF2a, putative
STRINGXP_002525146.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20113488
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-117bZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]