PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29634.m002055
Common NameLOC8273435, RCOM_0532860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GATA
Protein Properties Length: 398aa    MW: 44383.6 Da    PI: 6.445
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29634.m002055genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.61.7e-18315349135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  29634.m002055 315 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 349
                    *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.899309345IPR000679Zinc finger, GATA-type
SMARTSM004013.3E-14309363IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.23E-13311372No hitNo description
Gene3DG3DSA:3.30.50.101.9E-14313347IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.09E-13314356No hitNo description
PROSITE patternPS003440315340IPR000679Zinc finger, GATA-type
PfamPF003202.4E-16315349IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MLYQTTHHYH HPFIFHSPSA TTSSSFLFYC HLLLFRWEIE MECVEGALKT SFRKELGFKL  60
SPQAFFVDDL YALSMQNGTS SDDFIVDELL DFSNEEEAAV EREDEEEEEQ QQQQKACTAV  120
SVSLSPNQQQ TQRPEDGKIS DSTSNFATEL CVPADDLASL EWLSHFVEDS NSEYSTPFPA  180
AGIVSHENHK EENDNKPFYV TQKPVVLTET FFKTPVQTKA RSKRTRTGVR VWPLGSPSLT  240
ESSSSSSYTS SSSSSSSSSS SSSPLSPYLI FTTQGMSREL TEPICYEKTP IKKLKKRFSG  300
EPASGGGGSQ PPRRCSHCGV QKTPQWRTGP LGAKTLCNAC GVRFKSGRLL PEYRPACSPT  360
FCSELHSNHH RKVLEMRKKK EVVVQVEPGL VPPAVSSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002521500.10.0PREDICTED: GATA transcription factor 5
SwissprotQ9FH576e-73GATA5_ARATH; GATA transcription factor 5
TrEMBLB9S6810.0B9S681_RICCO; Putative uncharacterized protein
STRINGPOPTR_0007s13700.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-68GATA transcription factor 5