PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29613.m000372
Common NameLOC8267077, RCOM_0504000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family LBD
Protein Properties Length: 117aa    MW: 13033 Da    PI: 8.5683
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29613.m000372genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.61.4e-4051041100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+C++dC+++pyfp+++p++fa+vhk++Gasnv kll++lp   r  a++sl+yeA++r++dPvyG+vgvi+ l+qq+++++++la+
  29613.m000372   5 RCAACKYLRRRCPSDCIFSPYFPSSDPQRFACVHKIYGASNVGKLLQQLPAYLRASAADSLYYEAQCRIQDPVYGCVGVISLLHQQIHNAENQLAK 100
                    6**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  29613.m000372 101 TRAE 104
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.4534105IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-405102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MICGRCAACK YLRRRCPSDC IFSPYFPSSD PQRFACVHKI YGASNVGKLL QQLPAYLRAS  60
AADSLYYEAQ CRIQDPVYGC VGVISLLHQQ IHNAENQLAK TRAEIAVLSS FAQDITK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-38610512111LOB family transfactor Ramosa2.1
5ly0_B1e-38610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap29613.m000372
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530717.14e-82LOB domain-containing protein 24
SwissprotP594671e-52LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594681e-52LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9SXJ88e-81B9SXJ8_RICCO; LOB domain-containing protein, putative
STRINGXP_002530717.11e-81(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.14e-55LOB domain-containing protein 24