PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29613.m000367
Common NameLOC8267073, RCOM_0503960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 183aa    MW: 20558 Da    PI: 10.5543
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29613.m000367genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF725.3e-231562249
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   +i+ ks  qvtfskRr+g++KKA+EL++LC++e+a+i+fs+ gk + +
  29613.m000367 15 KISKKSHLQVTFSKRRAGLFKKASELCTLCGVEIAIIVFSPAGKAFSF 62
                   799****************************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-31665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.759666IPR002100Transcription factor, MADS-box
CDDcd002651.33E-31775No hitNo description
SuperFamilySSF554551.14E-25780IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-18828IPR002100Transcription factor, MADS-box
PfamPF003191.0E-241562IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-182843IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-184364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MKRCSLGRQK IAIEKISKKS HLQVTFSKRR AGLFKKASEL CTLCGVEIAI IVFSPAGKAF  60
SFGHPEVGSV LKRFLARNPL GSISCQFIQA DRNANVRELN VKLIHALNQL EAEKKRGEAL  120
NRMRKSSQSM CWWEAPVDEL GLQELEQLRY ALEDLKKNVA KEIDRVLGTT TSLPFLAGNS  180
FRL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29613.m000367
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530713.11e-132agamous-like MADS-box protein AGL61
SwissprotQ4PSU44e-57AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLB9SXJ41e-131B9SXJ4_RICCO; Mads box protein, putative
STRINGXP_002530713.11e-132(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-59AGAMOUS-like 61
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]