PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29598.m000468
Common NameLOC8269338, RCOM_0484650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 453aa    MW: 48973.7 Da    PI: 6.1071
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29598.m000468genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.54.4e-16248303358
                    XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                    + kr rr+ +NRe+ArrsR+RK+a + eLe+ v++L  eN++L k+l  ++ ++ +
  29598.m000468 248 DAKRVRRMLSNRESARRSRRRKQAHLTELETQVAQLRVENSSLLKRLTDISHKYNE 303
                    579*****************************************999988877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.9E-12245300No hitNo description
SMARTSM003382.0E-19246310IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.496248303IPR004827Basic-leucine zipper domain
PfamPF001707.1E-14249301IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11250300No hitNo description
PROSITE patternPS000360253268IPR004827Basic-leucine zipper domain
PfamPF124981.6E-47317441IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MDRVFSVDGI SEQFWSPPLP PPPPSSSSSA EDSSKKINRS ASEWAFQRFL QEANSVASTT  60
DSSSSSDVVV RDNHKTSDDA VVEIKDNKNN TNKYNDSSVS SANAQISNGR CAPPPFNAAA  120
PPPNIPADSE DYQAFLKSKL NLACAAVAQS RASFLKPEDS SARADSGLQA SNTSQLGSHA  180
PSKGAGHDVF RSQEVDVDGS VGIPSLPSTH KKSVVPLKPT TSGSSREQSD DDENEGETEL  240
TENMDPTDAK RVRRMLSNRE SARRSRRRKQ AHLTELETQV AQLRVENSSL LKRLTDISHK  300
YNESAVDNRV LKADVETLRA KVKMAEETVK RITGLNSLFH TIPEMSTMSM PSFDGSPSDT  360
STDAAVPVQD DTEHQFYQPP NNPLSTHDPR VNNALADISS VENVQPHSGA AGLGGNKMGR  420
TASLQRVASL EHLQKRIRGG ATPCETQSSG EHQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1262269RRSRRRKQ
2264269SRRRKQ
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap29598.m000468
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002531296.10.0light-inducible protein CPRF2
SwissprotQ990901e-141CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLB9SZ770.0B9SZ77_RICCO; Light-inducible protein CPRF-2, putative
STRINGXP_002531296.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41763358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.29e-72bZIP family protein
Publications ? help Back to Top
  1. Weisshaar B,Armstrong GA,Block A,da Costa e Silva O,Hahlbrock K
    Light-inducible and constitutively expressed DNA-binding proteins recognizing a plant promoter element with functional relevance in light responsiveness.
    EMBO J., 1991. 10(7): p. 1777-86
    [PMID:2050115]