PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29577.m000449
Common NameLOC8287639, RCOM_0454610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 425aa    MW: 46528.4 Da    PI: 6.5633
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29577.m000449genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44.1e-10223281563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                    kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  29577.m000449 223 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAEN 281
                    9*********************************************9998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-16219283IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.932221284IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-11223274No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-10223277No hitNo description
PfamPF001709.8E-9223277IPR004827Basic-leucine zipper domain
CDDcd147035.78E-26224273No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MDKDKGHSGG LPPPSGRFSS FSPTGSSFNV KPEPSSAAAL PPIAPGSSSD PSHFGHGSDS  60
SRFSHDISRM PDNPPKKLGH RRAHSEILTL PDDISFDSDL GVVGGADGPS FSDETEEDLF  120
SMYLDMDKFN SSSATSAFQL GESSIPTPAA LASASAQAPA TVDVGAGPSE RPRIRHQHSQ  180
SMDGSTTIKP EMLISGAEEV SPADTKKAMS AAKLAELALI DPKRAKRIWA NRQSAARSKE  240
RKMRYIAELE RKVQTLQTEA TSLSAQLTLL QRDTNGLTAE NSELKLRLQT MEQQVHLQDA  300
LNDALKEEIQ HLKVLTGQAM ANGGPMMNYN SFGTGQQFYP NNHAMHTLLT TQQFQQLQIH  360
SQKQQHQFQQ HQLHQLQQQQ QLQQQQQHQQ QEQQQQSGDL KMRGTMSSPN QKDNSSDVNS  420
TSANE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap29577.m000449
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529479.10.0probable transcription factor PosF21
SwissprotQ040881e-156POF21_ARATH; Probable transcription factor PosF21
TrEMBLB9SU100.0B9SU10_RICCO; Transcription factor RF2a, putative
STRINGXP_002529479.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55173249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-160bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]