PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29333.m001073
Common NameRCOM_0422020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 129aa    MW: 14673.1 Da    PI: 10.1119
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29333.m001073genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF391e-121255144
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                   k+ie+k + ++tf+kR +g++KK  EL+ L +a++a + fs++g
  29333.m001073 12 KKIEDKHQIETTFAKRTEGLFKKVDELCYLYGANAAAVTFSPHG 55
                   68***************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.475455IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-5626IPR002100Transcription factor, MADS-box
SMARTSM004323.9E-4864IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-13885IPR002100Transcription factor, MADS-box
PfamPF003191.1E-131360IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-52641IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MDRAIEGQYR RKKIEDKHQI ETTFAKRTEG LFKKVDELCY LYGANAAAVT FSPHGIRPYA  60
FGLPTSCSVI HHFLDGDDQR WFKKMVKTGF VGGGRCQQKV LDVAVIRVTF SPFLTTLTKF  120
MFMSSPVKS
Cis-element ? help Back to Top
SourceLink
PlantRegMap29333.m001073
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012074276.15e-16agamous-like MADS-box protein AGL61
TrEMBLB9SDL77e-92B9SDL7_RICCO; Uncharacterized protein
STRINGXP_002524086.11e-92(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36590.11e-12M-type_MADS family protein