PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29333.m001063
Common NameRCOM_0421420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 291aa    MW: 32439 Da    PI: 5.8339
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29333.m001063genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF405.1e-131151343
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                   i n+  r+ ++ kRr g+lKK +EL +LC++ + v+i+s++
  29333.m001063 11 IVNDAARKASLKKRRIGLLKKVSELTTLCGVSAFVVIYSPD 51
                   669999*********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.11149IPR002100Transcription factor, MADS-box
SMARTSM004329.1E-18160IPR002100Transcription factor, MADS-box
CDDcd002663.77E-24285No hitNo description
SuperFamilySSF554551.83E-21294IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-5323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-131151IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MTRKKVKLVW IVNDAARKAS LKKRRIGLLK KVSELTTLCG VSAFVVIYSP DEAEPMLWPS  60
RPVVQQMLMR YQNIPEIDRC KKTMNQELYL KERMGKIQEQ SKKSQKKNRE VEMSYLMDKL  120
HYQGNGVDDF ETGDTQILIW LLEERMRDMR KRVEYFQQVP PLLPPGYEFL PPPPPQGDHN  180
MEEMGQTNGG SEGGDQIRNN NPTDAMSLDQ WFLDMINNNE GFSGGGVDVG DLGLGLSLPL  240
PHSTFTIGNS SGGDNGNAAF GMGLPFPPMG GNSFGLGLPD GNTAGNNNVK D
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLVWIVNDAARKASLKKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMap29333.m001063
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015577799.10.0MADS-box protein AGL71, partial
TrEMBLB9SDK70.0B9SDK7_RICCO; Mads box protein, putative
STRINGXP_002524076.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110141938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.14e-30AGAMOUS-like 48