PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28966.m000534
Common NameRCOM_0364330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 325aa    MW: 35862.2 Da    PI: 8.4506
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28966.m000534genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.25.1e-1429681150
                   HHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
         SRF-TF 11 vtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    +f kR  ++ KKA+EL +LCd+ v+++ f+++g l +++
  28966.m000534 29 ASFLKRNPTLKKKAFELQTLCDVSVSIVSFGPDGGLETWP 68
                   69*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006610.9192371IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-122688IPR002100Transcription factor, MADS-box
PfamPF003191.6E-112767IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MGLSDPKKGS RRTSFMNKIL NGDRPTQAAS FLKRNPTLKK KAFELQTLCD VSVSIVSFGP  60
DGGLETWPDN EAQIRAAIMS YKELKPKDKR ESNLFKFLET KKAKLVKKKK QVMKRKLDVA  120
IQGLSKHVDG LSGQSLMDFV NLFEGKLKGF QEKLKSLESA AATQDDTLQA TICPDAINPL  180
LSSADCPVNS LVKFDIHQNN NQGPKDGTSA SLPRNCHNYP TTLGSFETGS FNQPRNDSYK  240
NLENCSGGNN FLYNSSTFGR AEVNYGNNAA LFDQFNSNNF FVGSSSSNSS FGIIEANDGE  300
ANAQENLGMV GENDIFWWDG NMVQY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100107KKAKLVKK
Cis-element ? help Back to Top
SourceLink
PlantRegMap28966.m000534
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB9ST930.0B9ST93_RICCO; Mads box protein, putative
STRINGXP_002529212.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1616059
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.16e-12AGAMOUS-like 103