PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28830.m000229
Common NameLOC8275940, RCOM_0339020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 197aa    MW: 21565.4 Da    PI: 6.3572
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28830.m000229genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.47.6e-231157349
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   i+ +s rqv+fskRr+gi+KKA+EL++LC++e+av+ifs+ gk +++
  28830.m000229 11 IQGESARQVSFSKRRTGIFKKASELCTLCAVEAAVVIFSPGGKAFTF 57
                   677899*************************************9999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-29160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-24171IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.399161IPR002100Transcription factor, MADS-box
CDDcd001201.99E-28260No hitNo description
PRINTSPR004048.6E-16323IPR002100Transcription factor, MADS-box
PfamPF003199.1E-231157IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGRKKTQMSL IQGESARQVS FSKRRTGIFK KASELCTLCA VEAAVVIFSP GGKAFTFGHP  60
CFEAIMKKLA DPENPDNGFA EHMAEHEATL RDLNKQYSDL LEQLKAEEKR GEELKQMLLL  120
DKPIDDLNLD ELLTLQAFME RAKADLLKRL GARPVQNSDP SASSSGNSTE AIDPSVTKSK  180
ANNADTHGNC HGVCNGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A8e-161111195MEF2 CHIMERA
6byy_B8e-161111195MEF2 CHIMERA
6byy_C8e-161111195MEF2 CHIMERA
6byy_D8e-161111195MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap28830.m000229
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002531994.21e-145agamous-like MADS-box protein AGL29 isoform X1
RefseqXP_015582587.11e-145agamous-like MADS-box protein AGL29 isoform X2
TrEMBLB9T1681e-144B9T168_RICCO; Mads box protein, putative
STRINGXP_002531994.11e-144(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1639169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.18e-32AGAMOUS-like 61