PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28617.m000204
Common NameLOC8266734, RCOM_0290330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 380aa    MW: 42702.2 Da    PI: 8.4277
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28617.m000204genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.17.7e-082452911763
                    HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                    A+rsR RK+++i+eLe+ v++L+ae ++   e+e l+++   l +e+
  28617.m000204 245 AQRSRVRKLQYIAELERNVQALQAEGSEVSAEVEFLNQQNLILNMEN 291
                    89***********************************9998888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-4234293IPR004827Basic-leucine zipper domain
CDDcd147031.71E-15236284No hitNo description
SuperFamilySSF579594.86E-6245287No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-5245286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MANSKGSPNV RNLMYSGKHA LLPPKIPFPS VSPSYVDYVP SNVIGSKAVQ RPREGNAHHQ  60
RTSSETLLIE EQPSWLDDLL NEPETPVRRG GHRRSSSDSF AYIDVANVSN IDYSTQDDYR  120
YKNMMSVLPS WGPQDYDYHK DARQVSLCAD VNMSKQKNRT WESSLNPAAR QSGLPSSREN  180
AVSQSSVSSC ALQEADGIQS SLSEKQDSAE SGPHDSKASS DRKDGCHAKS SVSETDTKRA  240
KQQFAQRSRV RKLQYIAELE RNVQALQAEG SEVSAEVEFL NQQNLILNME NKALKQRLES  300
LAQEQLIKYL EHEVLEREIG RLRALYKQQQ QPQQPQQQQQ PSSSHRRTNS RDLESQFGNL  360
SLKHKDASPG RDPVTGPLRT
Cis-element ? help Back to Top
SourceLink
PlantRegMap28617.m000204
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1478882e-90EF147888.1 Populus trichocarpa clone WS0125_L14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533021.10.0uncharacterized protein At4g06598
SwissprotQ8W3M72e-78Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLB9T4520.0B9T452_RICCO; Transcription factor RF2a, putative
STRINGXP_002533021.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51232637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-103bZIP family protein
Publications ? help Back to Top
  1. Kumekawa N,Hosouchi T,Tsuruoka H,Kotani H
    The size and sequence organization of the centromeric region of Arabidopsis thaliana chromosome 4.
    DNA Res., 2001. 8(6): p. 285-90
    [PMID:11853315]