PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28578.m000034
Common NameLOC8280800, RCOM_0277680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family HD-ZIP
Protein Properties Length: 368aa    MW: 40740.3 Da    PI: 8.2894
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28578.m000034genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.91.5e-17185239256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  28578.m000034 185 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 239
                    778899***********************************************98 PP

2HD-ZIP_I/II126.98.7e-41185275192
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                    +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+++ l+een+rL+ke +eLr +lk
  28578.m000034 185 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCEMLTEENRRLQKELQELR-ALK 275
                    69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046189.8E-576144IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.604.7E-17169235IPR009057Homeodomain-like
SuperFamilySSF466893.89E-18178242IPR009057Homeodomain-like
PROSITE profilePS5007116.86181241IPR001356Homeobox domain
SMARTSM003895.4E-15183245IPR001356Homeobox domain
CDDcd000861.57E-15185242No hitNo description
PfamPF000464.9E-15185239IPR001356Homeobox domain
PROSITE patternPS000270216239IPR017970Homeobox, conserved site
PfamPF021831.5E-10241275IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.8E-25241284IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MELALSLGDA SKPFKFLDNT TPKNNKMIPN KDLGFCMGLA TSGFAPRSQD KTHDHSHEGD  60
DDDGDRRRVL SSDRPVQLDL LPFSPVHPAR RQIPFPWLSD NMVSEPGSTD GSGGDRGFDV  120
NRLSVEEAEE GATLSSPNSA ASSFQMDFGI RSSGIGRGNK RDMECFEAER GSSRASDDDE  180
NGLTRKKLRL SKEQSAFLEE SFKEHNTLNP KQKLALAKQL NLRPRQVEVW FQNRRARTKL  240
KQTEVDCEYL KRCCEMLTEE NRRLQKELQE LRALKTSQPF YMQLPATTLT MCPSCERVAT  300
TTTSSSGTTT TTTNNNNGSS KNNNPVATTA ATTPSSTALS LANKPKLYPF SSHSQTQLPQ  360
AQSHKAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183189TRKKLRL
2233241RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap28578.m000034
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM2629443e-96AM262944.1 Phillyrea latifolia partial mRNA for type II homeodomain-leucine zipper protein precursor (ophh-61B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534537.10.0homeobox-leucine zipper protein HOX11
SwissprotP466651e-100HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9T8G80.0B9T8G8_RICCO; Homeobox-leucine zipper protein HAT14, putative
STRINGXP_002534537.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-85homeobox from Arabidopsis thaliana