PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28308.m000066
Common NameRCOM_0218410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family Trihelix
Protein Properties Length: 231aa    MW: 27689.6 Da    PI: 9.8626
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28308.m000066genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix68.51.4e-212721386
       trihelix 13 arremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                   +r e+++++ ++k++k lWe +s+km+e+gf+rs++qCk+kw+nl +ryk ++++e +    + +++p++++l+
  28308.m000066  2 IRAELDRTFMETKRNKLLWEVISNKMKEKGFHRSAEQCKCKWKNLVTRYKGCETMEPES--LR-QQFPFYNELQ 72
                   7999*****************************************************94..44.489*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122036.10E-18154No hitNo description
PfamPF138375.1E-17674No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MIRAELDRTF METKRNKLLW EVISNKMKEK GFHRSAEQCK CKWKNLVTRY KGCETMEPES  60
LRQQFPFYNE LQAIFAARMQ RMLWAEAEGG AGGSSKKKAV QVLSDEEDDN EDSEGEKGSI  120
KKKKKTKSTT TGGSGSVNNN NNLKEILRDF MRQQMQMEMQ WREAFEAREN ERRIKEMEWR  180
QTMEALENER IMMDRRWRER EEQRRMREEA RAEKRDALIT ALLNKLRREE M
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533637.21e-168PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW02e-64TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLB9T5W81e-167B9T5W8_RICCO; Transcription factor, putative
STRINGPOPTR_0006s10240.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.15e-45Trihelix family protein