PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28180.m000391
Common NameRCOM_0190350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 328aa    MW: 36284.6 Da    PI: 6.255
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28180.m000391genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.71.7e-141351442
                   -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
         SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                   e k +r+v+f+kRr g++ KA EL  LCda+ a+++ s+
  28180.m000391 13 ETKKQRSVSFTKRRYGLFNKAAELFMLCDAQLALLVSSP 51
                   77999*******************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-14162IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.764254IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-9424IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.06E-18575IPR002100Transcription factor, MADS-box
PfamPF003192.6E-151359IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-92439IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-93960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAKTRKLPMK KRETKKQRSV SFTKRRYGLF NKAAELFMLC DAQLALLVSS PCSRKVYSFG  60
HPSVDVILDA FLENHLPIAS DGKVKQRALS LLNEIKGLER DIKSSSTQRN KNLENVASGF  120
SSVFECFENS QSIEELRPVV NALEKLVDEA KSRANNSVSC VLRNENGGDG VVQIADDSSL  180
ITTNGFCSLN QTDYISSCNI SDTSPTAKID SNNVLTLQDS DSVHNSDRTS VLPLNVPIGK  240
KSNNLLELPE STSWIHYSGM KGKQVDSNII TDHVHNSGCV NGYKIIDGKT NSGQDENWDW  300
ANFSSSDITY QTVPAGNNYE DLLDWLFS
Cis-element ? help Back to Top
SourceLink
PlantRegMap28180.m000391
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025015356.10.0MADS-box protein SVP-like
TrEMBLB9T1590.0B9T159_RICCO; Mads box protein, putative
STRINGXP_002531977.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14582714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.16e-17AGAMOUS-like 61