PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27973.m000086
Common NameRCOM_0135210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family G2-like
Protein Properties Length: 356aa    MW: 38876.8 Da    PI: 6.7501
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27973.m000086genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-32239292255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  27973.m000086 239 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 292
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15236293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-29237293IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-24239292IPR006447Myb domain, plants
PfamPF002494.8E-7240291IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MSRNKGGIFY GKQSLNQIPD LSLHISLPNS APSSICIGTN DADDSSFHGW HKDDDDDDDV  60
DVGLKSHSDS SIKVGSNIQP VDDDIELSLA NPTSTALEAE SPWRRTSNFA SDGRRANCSK  120
EDQARQRNLL SRANNNGISV FEVSGFKSIK GIPVYSTGEI MDPRFCFNQM AYSSSCTPYP  180
STDNCSFPAF RIGTSYHHHH QYASGAGGGG GGAAEVYGSG IIRSRFMPKL QNKRNMRAPR  240
MRWTSSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKSTDKPA  300
ASSDGSGDED FLSVTTPITQ NSSHFLNPTR GSVSLENDDD NNVGYPPSTL WSNSSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-18240294458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-18240294458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-18240294357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-18240294357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-18240294357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-18240294357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-18240294458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-18240294458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-18240294458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-18240294458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-18240294458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-18240294458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap27973.m000086
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533735.20.0transcription repressor KAN1
TrEMBLB9T6660.0B9T666_RICCO; DNA binding protein, putative
STRINGXP_002533735.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-52G2-like family protein