PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27914.m000409
Common NameRCOM_0111710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family G2-like
Protein Properties Length: 441aa    MW: 48891.2 Da    PI: 9.2419
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27914.m000409genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-32303356255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  27914.m000409 303 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 356
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15300356IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28301356IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23303356IPR006447Myb domain, plants
PfamPF002498.1E-7304355IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MPLEGVFIEP SSNPVPDLSL HISPPNTSSS SVCNNSIINN KSTTDTTGFN LLSRQEGIHN  60
LKSNSMRIDS QAYTELSLAH PATTNVVDDE TRIRRNFTAS STATAQEPPH NPYQQQSHNH  120
LHQHHHNTHH LNHLNHGVSL LDVSDGLRPI KGIPVYHNRS FPFMSSSEQQ QQLQSSRENS  180
NNNISRDPKM CFYQMPYHPS SSSSSLCSPS VSHTSSPYYI GDPMSMLNSS SGVPNNHHQS  240
LPSYNRLAAT ARFNGLSMDA FKSHHQLHHH HHQYGVGSGE ASHGLIRSRF LPKLPTKRSM  300
RAPRMRWTST LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT  360
DKPAASSDGS GEEDISTMGS GNDRGSGGLR RFSDQRGASD GSVQQEMSYP STATTLWSNS  420
SRIKRVPVAA FALFILNFLF D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-16304358458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-16304358458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-16304358357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16304358357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16304358357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16304358357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-16304358458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-16304358458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-16304358458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-16304358458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-16304358458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-16304358458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap27914.m000409
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015580428.10.0transcription repressor KAN1 isoform X1
TrEMBLB9SR790.0B9SR79_RICCO; Transcription factor, putative
STRINGXP_002528498.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-64G2-like family protein