PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27893.m000228
Common NameLOC8271847, RCOM_0104800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 349aa    MW: 38264.6 Da    PI: 4.7477
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27893.m000228genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.92e-161151242
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                   + e++ +r+v+f+kRrng++ KA EL  LCda+ av+++s+
  27893.m000228 11 KLESQKQRSVSFTKRRNGLFNKAAELFMLCDAQLAVLVASP 51
                   6799***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-15265IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.367254IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-9424IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.2E-17578IPR002100Transcription factor, MADS-box
PfamPF003191.3E-161262IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-92439IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-93960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MFKPRKRPMK KLESQKQRSV SFTKRRNGLF NKAAELFMLC DAQLAVLVAS PCSKPKRKVY  60
SFGHPSADVV LDAFLNNCAP VPVDNGARQS ALSLLGEIKG LESEINSLSQ RNARLTNVGD  120
GFSSAFQYFE NSKSIEELQA VVDVLEKLIV EAKSRVSNSI SWVPSNENGN GFCTLNQPDN  180
GFCFTNNNIP STSKSFGDDL SMFQDSASGY NYDSNSVLPV DNKEKNLLVV PGSSHSCFNY  240
NDKGKEKLAD CNMIRDPVTS YFGCLNDYGI VGETSNSRLD ENWSLTNCST SHNSSCSLSD  300
MTANYVYNQA PLDFSGAVGT LDTTLQDLAA AADDVYGDSA FLDDLWSYQ
Cis-element ? help Back to Top
SourceLink
PlantRegMap27893.m000228
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002532176.10.0agamous-like MADS-box protein AGL62
TrEMBLB9T1Q70.0B9T1Q7_RICCO; Mads box protein, putative
STRINGXP_002532176.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14582714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49420.19e-17M-type_MADS family protein