PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27866.m000233
Common NameRCOM_0101370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 217aa    MW: 24476.7 Da    PI: 6.5328
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27866.m000233genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.62.9e-222068149
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   k+ie ksn qvtfskRr+g++KKA+ELS LC+a+vav+ fs+  k++ +
  27866.m000233 20 KPIEGKSNLQVTFSKRRAGLFKKASELSLLCGAQVAVLAFSPGKKVFAF 68
                   68****************************************9999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-291271IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.8241272IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.28E-271388IPR002100Transcription factor, MADS-box
CDDcd002652.48E-351382No hitNo description
PRINTSPR004045.5E-191434IPR002100Transcription factor, MADS-box
PfamPF003196.0E-232268IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-193449IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-194970IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MVIIKNHQKR TKGRQKIEIK PIEGKSNLQV TFSKRRAGLF KKASELSLLC GAQVAVLAFS  60
PGKKVFAFGH PNVETVLDRY LNEGNPDAKE DTAQTVTSDS PRVQQWNKEY EDAMKELEEE  120
KKCLAMVEEW KKVRESNVNG GFWWDEPVDD MGVEELEEYA KALKELKRNV GIRANELMMI  180
GNNHHIVNNN QNNLGYGVGT SDLGFGFGDG PFLKFDG
Cis-element ? help Back to Top
SourceLink
PlantRegMap27866.m000233
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002532452.21e-160agamous-like MADS-box protein AGL62
TrEMBLB9T2I31e-159B9T2I3_RICCO; Mads box protein, putative
STRINGXP_002532452.11e-160(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-42AGAMOUS-like 62