PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27732.m000277
Common NameRCOM_0065570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 330aa    MW: 37358.6 Da    PI: 7.7326
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27732.m000277genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.52.3e-153984550
                   SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
         SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                   +k  ++ +f kR+ ++ KKA+EL +LCd+ v+v+ f+++g +  ++
  27732.m000277 39 DKATKTASFYKRKPTLKKKAQELHTLCDVPVCVVCFGPNGSVDVWP 84
                   6788999***********************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-42585IPR002100Transcription factor, MADS-box
CDDcd002666.61E-1732109No hitNo description
PROSITE profilePS5006611.5633887IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.42E-1638106IPR002100Transcription factor, MADS-box
PfamPF003191.4E-143981IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAACQGNSPQ ETKKRGRAVL DGDKEARKQN FIRKILDDDK ATKTASFYKR KPTLKKKAQE  60
LHTLCDVPVC VVCFGPNGSV DVWPEEEQCA KELMMSYKRS DKKERKESNV LELMQCKKKK  120
LEKKKQEVKI NALVSTLSKC LDGLSGIPLI DRVNELQDKL KIFKERIELL SMEKKRKRIE  180
TPDEEISPIV SILSSPKNQE FDNILLWPTS TSCSNLARPE GFDMAGTNNH SVVEDEVNSN  240
VLLNNSNVLY GFQQIDPTVL DMSPGNLDML ENSDNYFVPF DHQHQISYIH DAMPISVWEP  300
PQPLVHTVRS SGSSNVDSRN YFPAAGSTVR
Cis-element ? help Back to Top
SourceLink
PlantRegMap27732.m000277
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB9SZJ70.0B9SZJ7_RICCO; Mads box protein, putative
STRINGXP_002531416.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1616059
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.11e-13AGAMOUS-like 103