PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G174300.1
Common NamePHAVU_011G174300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 176aa    MW: 19164.9 Da    PI: 8.3768
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G174300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601413.7e-44131121100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++l e +r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+
  Phvul.011G174300.1  13 PCAACKLLRRRCAQDCVFAPYFPADEPHKFASVHKVFGASNVNKMLQELAEYQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQVDVLR 103
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++lal+++e
  Phvul.011G174300.1 104 TQLALAEAE 112
                         ****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.56812113IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4313110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MKDAGRKQGT LSPCAACKLL RRRCAQDCVF APYFPADEPH KFASVHKVFG ASNVNKMLQE  60
LAEYQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQQQVD VLRTQLALAE AEVVQMRMSQ  120
VSSSSHQPKP VPAPSNSSSQ NLSPPRRLAM ATTNSLFSMD MVVDHPNMGE SLWSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-4791237121LOB family transfactor Ramosa2.1
5ly0_B8e-4791237121LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.011G174300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133379.11e-128hypothetical protein PHAVU_011G174300g
SwissprotQ9SHE92e-68LBD4_ARATH; LOB domain-containing protein 4
TrEMBLV7AKI81e-127V7AKI8_PHAVU; Uncharacterized protein
STRINGXP_007133379.11e-127(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.16e-64LOB domain-containing protein 4