PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G157100.1
Common NamePHAVU_011G157100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NZZ/SPL
Protein Properties Length: 389aa    MW: 42316.1 Da    PI: 9.9871
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G157100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE22.91.5e-07287951103
              NOZZLE  51 taqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaaisntatrlp 103
                           + k kk   rg+gva+le+ ++eee k+ ++a+   ts++ +++n+   l 
  Phvul.011G157100.1  28 CKKPKPKKVPQRGLGVAQLEKIRLEEEEKEKAAAA-AATSAIGSSNNSPCDLR 79 
                         34456788889***************999987665.56888888888765443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087444.0E-52874IPR014855Plant transcription factor NOZZLE
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGEDDESSKS KNDGAGAGGS RKGAGRPCKK PKPKKVPQRG LGVAQLEKIR LEEEEKEKAA  60
AAAATSAIGS SNNSPCDLRL QFANFPHTNH PSSPNSLPSS TVSLANSGGS EACLHGVPPQ  120
GRVGGPHLWT PHNFENENKN LRMDPKLTLA STLPSESNPI SPSFNWVQRT QQQQHHHPSS  180
SMVSASSGTS STNVPNPLIE IPSNQNYSGC YVSKRQEERM TGIKRPSSFS LENPPLSSSN  240
FKSLSFPSPM KVSETISCRR GREFNLDFSN STIREIPSLE PSNSDLNSKK KKKENNNFGG  300
DFLRLAPPIP CSNFKSTSAF QPFHNLGIIK NQVPPPSGYK QFNQQQQHWY NFIPPSSNAA  360
LIGHQQSDRF QNCNMVGRSA NLDLSLKL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.011G157100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-139AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133165.10.0hypothetical protein PHAVU_011G157100g
TrEMBLV7AHZ80.0V7AHZ8_PHAVU; Uncharacterized protein
STRINGXP_007133165.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89561213