PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G064900.1
Common NamePHAVU_011G064900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family WOX
Protein Properties Length: 264aa    MW: 29752.8 Da    PI: 6.0851
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G064900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.34e-212079357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R+++tkeq+  Le+l+++  ++psaee+++++++l    +++ ++V++WFqN++a++++
  Phvul.011G064900.1 20 SRWNPTKEQISMLENLYKQgIKTPSAEEIQQITARLraygHIEGKNVFYWFQNHKARQRQ 79
                        7*****************99**************************************97 PP

2Wus_type_Homeobox115.91.9e-371881265
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        a++RW+Pt+eQi +Le+lyk+G++tP++eeiq+ita+L++yG+ie+kNVfyWFQN+kaR+rqkq
  Phvul.011G064900.1 18 ASSRWNPTKEQISMLENLYKQGIKTPSAEEIQQITARLRAYGHIEGKNVFYWFQNHKARQRQKQ 81
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.1751580IPR001356Homeobox domain
SMARTSM003898.9E-71784IPR001356Homeobox domain
SuperFamilySSF466898.13E-132086IPR009057Homeodomain-like
PfamPF000467.3E-192079IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.7E-92079IPR009057Homeodomain-like
CDDcd000863.61E-82181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MESENEELEM GGSNGVAASS RWNPTKEQIS MLENLYKQGI KTPSAEEIQQ ITARLRAYGH  60
IEGKNVFYWF QNHKARQRQK QKQETIAYFN RFLHTPQPFF SPPICPNGLC PPYCVPQAQS  120
ENGFYPPHPK VLVPVGFRRS PSEIFVPTDM SNMISNGPLA YEAMQQRISD CNFSYSNQET  180
LDLFPLHPTG ILEGKTTYQV SSLASVSADS SSDTPPAPSP DINEDDPSPL NQPFFDFLLL  240
LVKVLKRLLL CHWLELLIPM AHH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.011G064900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-156AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132075.10.0hypothetical protein PHAVU_011G064900g
TrEMBLV7AEV00.0V7AEV0_PHAVU; Uncharacterized protein
STRINGXP_007132075.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-54WUSCHEL related homeobox 2