PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G057500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 171aa    MW: 18704.3 Da    PI: 9.0015
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G057500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.32.7e-43141131100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lp ++r da+ss+vyeA+ar+rd vyG+vg i++lqqq++ l+
  Phvul.011G057500.1  14 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQDLPMHQRGDAVSSMVYEANARVRDLVYGCVGAISSLQQQIDVLQ 104
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++lal+++e
  Phvul.011G057500.1 105 TQLALAQAE 113
                         ****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.45413114IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4314111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MKESGGRKQG AASPCAACKL LRRRCAQDCV FAPYFPADEP QKFANVHKVF GASNVNKMLQ  60
DLPMHQRGDA VSSMVYEANA RVRDLVYGCV GAISSLQQQI DVLQTQLALA QAEVAHLRVR  120
QNRPFSSYGP RPNSPTNSGF PSPKTLDSHA KPIFDMDMVM DHASYGSSMW *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-49101147111LOB family transfactor Ramosa2.1
5ly0_B9e-49101147111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.011G057500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0907165e-99BT090716.1 Soybean clone JCVI-FLGm-5M9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535054.11e-111LOB domain-containing protein 4
RefseqXP_028180280.11e-111LOB domain-containing protein 4-like
SwissprotQ9SHE93e-73LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0B2QS871e-109A0A0B2QS87_GLYSO; LOB domain-containing protein 4
TrEMBLI1L0C81e-109I1L0C8_SOYBN; Uncharacterized protein
STRINGGLYMA09G02510.11e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-75LOB domain-containing protein 4