PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G052100.1
Common NamePHAVU_011G052100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 969aa    MW: 106764 Da    PI: 5.7981
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G052100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.9e-29597647252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Phvul.011G052100.1 597 EKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 647
                         79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.904586667IPR003035RWP-RK domain
PfamPF020422.5E-26599647IPR003035RWP-RK domain
SuperFamilySSF542773.36E-22862952No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-23865947No hitNo description
PROSITE profilePS5174522.936868950IPR000270PB1 domain
SMARTSM006662.1E-23868950IPR000270PB1 domain
CDDcd064073.37E-30869949No hitNo description
PfamPF005642.9E-17871949IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 969 aa     Download sequence    Send to blast
MEDHFCPKGN ETGYCTSPGA QLEESTSVDG GMKKSASEDM FSNFSELMNF DTYAGWNNSS  60
CMTYQSLANV FSSFSSASYP PSEGLNLVEH GNGPCFMTEV SEIHSGMESS PSCEERGIFQ  120
QMDIQLGFLD EANDSNSFDS KQNRNGTYQQ LNTSDMCNYL ISRSSGRPLD DRILRALSFF  180
MESVDGEMLA QVWVPIKHGD EFILSTSEQP YLLDPKLAGY REVSRAFTFS AEGKKGSCPG  240
LPARVFISHV PEWTSNVGYY NKTEYLRLDH ALNHEIRGSI ALPISDLHSL VPCAVLELVT  300
TKEKPNFDRE LEIVTHALQL VNLKTITPPR LLPQSLSSNK RAALTEILDV LRAVCHAHRL  360
PLALTWIPCS YSEGLGDESE RIQIKEGHTS SNEKCVLCIE ESACYINDGA LGGFVHACVE  420
HHLEEGQGIA GKALQSNHPF FYTDVKTYDI GEYPLVHHAR KYNLNAAVAI RLRSTYTNDD  480
DYILEFFLPV TMTGSSEQQL LLDNLSGTMR RICRSLRTVS DAELTGIEGS VAEFPKEKAT  540
YFFPMSKRNS QIAFINDDHD SVQKMSLKAS NNGIEAVHSQ VVNGSRKQIE KKRSTVEKNV  600
SLSVLQQYFS GSLKDAAKSI GVCPTTLKRI CRQHGISRWP SRKINKVNRS LKKIQTVLDS  660
VQGVEGGLKF DPYTGGLIAG GSIMQEIDTH KYILFPEKSA VKDPKHATQK PVSVVPAPGS  720
TSENSTIKLD NDDGVCLVGN KLVHSRSVLI SDTSEGGLKK DNASSDDCCE DSKSVAMNDG  780
SSQKGSKRAK NQDCPDQTCS ISLVTDEVEV GVDGGEGIDE HNHLNSSSTT HSSNGSGSMM  840
HGSSSRSQSF ENQKHSKVKS TCVHSGSKMI VKASYRGDTI RFKFDPSAGC FQLYDEVATR  900
FKLQNGSFQL KYLDDEEEWV MLVNDSDLQE CIEILDDIGT RCVKFLVRDV PCVLSSRGSN  960
NCFLSDSS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.011G052100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007131923.10.0hypothetical protein PHAVU_011G052100g
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLV7AEB70.0V7AEB7_PHAVU; Uncharacterized protein
STRINGXP_007131923.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]