PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G039600.1
Common NamePHAVU_011G039600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family GATA
Protein Properties Length: 304aa    MW: 33455.5 Da    PI: 5.1599
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G039600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.68.1e-19218251134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  Phvul.011G039600.1 218 CSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGR 251
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.1E-801302IPR016679Transcription factor, GATA, plant
SMARTSM004013.2E-14212262IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.227212248IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.37E-14214275No hitNo description
Gene3DG3DSA:3.30.50.101.9E-14216249IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.24E-15217274No hitNo description
PROSITE patternPS003440218243IPR000679Zinc finger, GATA-type
PfamPF003201.6E-16218251IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEVAAAKALK PSLRTEFIFP QAICDEILCF NANNIVVGED FSVDDLLDFS NGEFQLGKDF  60
DVCEEEEDEE KDSSSGSLQD RIEDDSNSNS AACGGGDSVF AGELSVPADD VADLEWVSHF  120
VDDSLPELSL LYPVPAAKTR VRTEPEPRPG RAQTASTVPK RLRTEKSRKP NARVWSFTVS  180
PPFLCSPVLA GVEFGEPTAK KQKKKAEAQS GTQFQRRCSH CQVQKTPQWR TGPLGPKTLC  240
NACGVRFKSG RLFPEYRPAI SPTFSGEIHS NSHRKVLEMR RRKETTEPVL ETGSDRTQLV  300
PSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007131761.10.0hypothetical protein PHAVU_011G039600g
RefseqXP_007131760.10.0hypothetical protein PHAVU_011G039600g
TrEMBLV7AET00.0V7AET0_PHAVU; Uncharacterized protein
STRINGGLYMA12G04180.21e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.15e-51GATA transcription factor 7