PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G138500.1
Common NamePHAVU_010G138500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 329aa    MW: 36748.8 Da    PI: 5.7705
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G138500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601261.8e-39501491100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k ++++++++a+++++y++++ra dPv G+++ il+lq q+e  +
  Phvul.010G138500.1  50 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKVVSPHDKDQAVRTIIYQSDMRATDPVGGCYRYILDLQAQIEYCR 140
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ael+l+ ++
  Phvul.010G138500.1 141 AELELVLQQ 149
                         ***998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.64249150IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3750146IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MQPKSRFFVP PQKAVNNNNN SNTTTTTPTS STTTNNRIST TRNGNSTTQA CAACKYQRRK  60
CAPDCILAPY FPHDRQRQFL NAHKLFGVSN ITKIIKVVSP HDKDQAVRTI IYQSDMRATD  120
PVGGCYRYIL DLQAQIEYCR AELELVLQQL AMFRAQAQNQ HQYQQQHGMY APNNVNVAVN  180
GDGEVLNADP MGLYSQQQYQ CLQPHQQEQY VMMHENGSQN CNGATPLQEQ INTWAVQNTA  240
VSLSSLSLQG QSSNVSDEYD HKPVIDIDSD ERSELGFESE ELVHRSDEAV LFKIDDAVIK  300
AEGECMQQAQ DHDLKGAATS FSLTNCTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-265115312114LOB family transfactor Ramosa2.1
5ly0_B4e-265115312114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.010G138500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135547.10.0hypothetical protein PHAVU_010G138500g
TrEMBLV7ATK50.0V7ATK5_PHAVU; Uncharacterized protein
STRINGXP_007135547.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.19e-56LOB domain-containing protein 22