PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G090300.1
Common NamePHAVU_010G090300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 832aa    MW: 90836.6 Da    PI: 5.9617
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G090300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.4e-21130185156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe++F+++++p++++r eL+k+l+L++rqVk+WFqNrR+++k
  Phvul.010G090300.1 130 KKRYHRHTPQQIQELEAFFKECPHPDEKQRLELSKRLSLETRQVKFWFQNRRTQMK 185
                         688999***********************************************999 PP

2START211.23.8e-663375621206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+a+a+ep+Wv+ +    e+ n +e++++f++  +     + ++a+r+ g+v+ ++  lve+l+d + +W e+++    +
  Phvul.010G090300.1 337 ELALAAMDELVKMAQAGEPLWVRNVeggrEIMNHEEYVRTFTPCIGlrpngFVSDASRENGMVIINSLALVETLMDAN-RWAEMFPciiaR 426
                         5899**************************************9999********************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksngh 161
                          +t evis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++ +   +s+v +++lpSg+++++++ng+
  Phvul.010G090300.1 427 TSTAEVISNGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDSIRESSGaPPSFVNCRRLPSGCVVQDMPNGY 517
                         ****************************************************************99999********************** PP

                         EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         skvtwveh++++++++h+++r+l++sg+ +ga++wvatlqrqce+
  Phvul.010G090300.1 518 SKVTWVEHAEYDESQVHQVYRPLLSSGMGFGAQRWVATLQRQCEC 562
                         *******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.59E-20116187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-21116181IPR009057Homeodomain-like
PROSITE profilePS5007117.637127187IPR001356Homeobox domain
SMARTSM003891.4E-19128191IPR001356Homeobox domain
CDDcd000861.12E-19129187No hitNo description
PfamPF000462.3E-18130185IPR001356Homeobox domain
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
PROSITE profilePS5084844.696328565IPR002913START domain
SuperFamilySSF559612.06E-35330562No hitNo description
CDDcd088751.37E-124332561No hitNo description
SMARTSM002344.9E-50337562IPR002913START domain
PfamPF018521.5E-57337562IPR002913START domain
SuperFamilySSF559611.18E-23589824No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 832 aa     Download sequence    Send to blast
MSFGGFLENK SGSGSARNDV SDIPYNDVTT TNHTNNNNDD RMPFGAISQP RLVTTTPTLA  60
KSMFNSPGLS LALQTNIDGQ EDVNRMVENS FEPNGLRRSR EEEHESRSGS DNIDGASGDE  120
QDAADNPPRK KRYHRHTPQQ IQELEAFFKE CPHPDEKQRL ELSKRLSLET RQVKFWFQNR  180
RTQMKTQLER HENTLLRQEN DKLRAENMSI RDAMRNPMCS NCGGPAIIGE ISLEEQHLRI  240
ENARLKDELD RVCALTGKFL GRPVSSLPNS SLELGVGGNG FGGISMSTTM PLGQDFGMGM  300
SMSVSNNPLA MVSPSSTRPT SVVGGFDRSI ERSMFLELAL AAMDELVKMA QAGEPLWVRN  360
VEGGREIMNH EEYVRTFTPC IGLRPNGFVS DASRENGMVI INSLALVETL MDANRWAEMF  420
PCIIARTSTA EVISNGINGT RNGALQLMHA ELQVLSPLVP VREVNFLRFC KQHAEGVWAV  480
VDVSIDSIRE SSGAPPSFVN CRRLPSGCVV QDMPNGYSKV TWVEHAEYDE SQVHQVYRPL  540
LSSGMGFGAQ RWVATLQRQC ECLAILMSSA APSRDHSAIT AGGRRSMVKL AQRMTNNFCA  600
GVCASTVHKW NKLNPGNVDE DVRVMTRKSV DDPGEPPGIV LSAATSVWLP VSPQRLFDFL  660
RDERLRSEWD ILSNGGPMQE MAHIAKGQDH GNCVSLLRAS AINSNQSSML ILQETCIDEA  720
GSLVVYAPVD IPAMHVVMNG GDSAYVALLP SGFAIVPDGP GSRGSQNGTT TTANGGDNGG  780
ARVSGSLLTV AFQILVNSLP TAKLTVESVE TVNNLISCTV QKIKAALHCE S*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.010G090300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134961.10.0hypothetical protein PHAVU_010G090300g
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLV7ANR50.0V7ANR5_PHAVU; Uncharacterized protein
STRINGXP_007134961.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]