PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G000200.1
Common NamePHAVU_010G000200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Trihelix
Protein Properties Length: 272aa    MW: 32237.2 Da    PI: 7.1546
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G000200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.42.2e-2434116186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W+ qe+++ + +r e+++++ ++k++k+lWe +s +m+e+g++rs++qCk+kw+nl +ryk  +++e++    +++++p++++ +
  Phvul.010G000200.1  34 QWSIQETKEFLVIRAELDQTFMETKRNKQLWEVISTRMKEKGYHRSAEQCKCKWKNLVTRYKGFETMEQEA---TRQQFPFYNEFN 116
                         7********************************************************************96...45679**99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122035.56E-223396No hitNo description
PfamPF138379.9E-2034118No hitNo description
PROSITE profilePS500907.2943591IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEGHHLHRHH GQQQQRLQPQ NTSANVDVTD RFPQWSIQET KEFLVIRAEL DQTFMETKRN  60
KQLWEVISTR MKEKGYHRSA EQCKCKWKNL VTRYKGFETM EQEATRQQFP FYNEFNAIFT  120
ARMQRMLWAE AEGGSKKNKG TQLSSDEEED GNEESAEAGG GRKKKKAKIA SGGGGGSSSL  180
NSLKEILEEF MRQQMQIEAQ WMEAFEAREN ERRLKEMEWR QAMEVLENER IMMEERWRER  240
EEQRRIREEA RAEKRDALIT ALLNKLERQE M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133883.10.0hypothetical protein PHAVU_010G000200g
SwissprotQ9SDW08e-70TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLV7AJV30.0V7AJV3_PHAVU; Uncharacterized protein
STRINGGLYMA03G07590.21e-145(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-51Trihelix family protein