PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G213800.1
Common NamePHAVU_009G213800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 363aa    MW: 41148.7 Da    PI: 6.0494
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G213800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF26.39.6e-09952144
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                        k+i n + r   f kR++ ++K  +E +  C++++ +ii+  +g
  Phvul.009G213800.1  9 KPITNARDRDLAFMKRKKALMKTISEFCSVCGVKAGLIIYDGKG 52
                        6899***********************************97665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-5160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.848161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-14284IPR002100Transcription factor, MADS-box
PfamPF003191.4E-91152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGRPKLILKP ITNARDRDLA FMKRKKALMK TISEFCSVCG VKAGLIIYDG KGDSPPLTWP  60
QDPIEMQSII QRYESMMSEK IPKNFDLNNF FEIRKNMVDS EISKLQKDIL ETKYPTWHPL  120
FSTLGAEELK NFIASLDIKL EACNQRTKMF ECKKQTEAQF NFKQCLIQPG SVAPNSNQLI  180
SMQDIFQNQL LFAPMKPLNA DLAPFLQYNL EKGSSSLSQK LNFDANLMQM KAGNEVLVNK  240
TNEVAVPQEH ACQIDVFRNP SNQFDVFKNP SNQFDVPCDL LDDSLNFFNQ LGDIQSLNQQ  300
WGNNQHDAHV IGGSSTTMNG GVTTYDTNFH GNQYNPEFSL CNYNGVMQSY NNNASWQNIG  360
FQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G213800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138494.10.0hypothetical protein PHAVU_009G213800g
TrEMBLV7B0S60.0V7B0S6_PHAVU; Uncharacterized protein
STRINGXP_007138494.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-15M-type_MADS family protein