PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G204300.1
Common NamePHAVU_009G204300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family bZIP
Protein Properties Length: 189aa    MW: 21495.9 Da    PI: 8.0543
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G204300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.21.3e-1199156663
                         HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         r +r+ +NRe+ArrsR  Kk++ie L+   + L++ N++L +++  l +  ++  +++
  Phvul.009G204300.1  99 RKKRMFSNRESARRSRMQKKQQIESLQCHLDHLQTLNRQLSEKIIYLLECNQQILQHN 156
                         89****************************************9987777777666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-993158IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.1496145IPR004827Basic-leucine zipper domain
PfamPF077162.4E-1097143IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-999153No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-1199154No hitNo description
CDDcd147021.68E-1199147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MEGNEAKRLG GPPNFSTLTQ HSSFLSPTQN STLNNETTEG HMRYRDCIFT HVDSSQVLHH  60
IPLYCSRLHL SNNTNSPNTS SNSNNNNNAD EAIALLEDRK KRMFSNRESA RRSRMQKKQQ  120
IESLQCHLDH LQTLNRQLSE KIIYLLECNQ QILQHNAQLK DKVSYLQVAV SELLGPPGHV  180
DQSNHFPH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G204300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138387.11e-138hypothetical protein PHAVU_009G204300g
TrEMBLV7B1P21e-136V7B1P2_PHAVU; Uncharacterized protein
STRINGXP_007138387.11e-137(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.15e-25basic leucine-zipper 70