PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G194200.1
Common NamePHAVU_009G194200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ARR-B
Protein Properties Length: 677aa    MW: 73780.4 Da    PI: 5.4076
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G194200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.57.2e-29211264155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Phvul.009G194200.1 211 KPRVVWSVELHRKFVAAVNQL-GLEKAVPKKILDLMNVEGLTRENVASHLQKYRL 264
                         79*******************.********************************8 PP

2Response_reg84.24e-28261341109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ +++l+++l+k +y +v+++ ++ eal++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + 
  Phvul.009G194200.1  26 VLAVDDNPTCLKVLENLLRKCQY-QVTTTNQAVEALKMLRENRhkFDLVISDVDMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMQG 114
                         799********************.***************887778*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  Phvul.009G194200.1 115 VTHGACDYLLKPVRIEELKN 134
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.5E-1661676IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23003.0E-4323157No hitNo description
SuperFamilySSF521721.85E-3623145IPR011006CheY-like superfamily
SMARTSM004489.7E-3524136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.85425140IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-2526134IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.73E-3027139No hitNo description
Gene3DG3DSA:1.10.10.602.9E-30208268IPR009057Homeodomain-like
PROSITE profilePS5129411.584208267IPR017930Myb domain
SuperFamilySSF466891.16E-19209268IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-24211264IPR006447Myb domain, plants
PfamPF002492.0E-7213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MAVENQRDHL GDEDGCVDRF PVGMRVLAVD DNPTCLKVLE NLLRKCQYQV TTTNQAVEAL  60
KMLRENRHKF DLVISDVDMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTKL VMQGVTHGAC  120
DYLLKPVRIE ELKNIWQHVV RRKNFDGRDQ SKASNDEKAL NIAGEGSPSL RSENSGDQNR  180
RLGKKRKDQS EEEEDDGEGN GDDDDPSAQK KPRVVWSVEL HRKFVAAVNQ LGLEKAVPKK  240
ILDLMNVEGL TRENVASHLQ KYRLYLKKAN HQANMVAALG GSDSYLRMGS IDGFGDFCTA  300
SGSGRISNTT LPSYASSGIF SRLNSPAGLN MRGISSSALI RPVQTQSINS SLNTLGNIQP  360
SIFSANQNSS LLQGIPTSIE LNQSKQNNCS TGLSQRSQVD SSGFAVASGF PDSRAAVNGP  420
NNSISCGSNN HIILQGNPQQ THSPGAFRNQ SSVRAASLSA ESFGICGSSN MLDYNRCNED  480
WQNAAQLSKF PANSLPLCEA FSNDQLPPPG INVSNSGTHI GNSPVGFSPR MAMTVPLEDI  540
QPLSYTPQQR WEEHKLDYDQ NMSRPFNPVN SYASSSAATS SMGRGLNQNN TICSNRIDAS  600
LVGPCTEVDK FSSDIPLKSN EAYILEQLKS QEGFMHNTFG TLDDIMGAMV KREQNELTLL  660
DGEIGFDASY PVGSCN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-26207270164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G194200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138266.10.0hypothetical protein PHAVU_009G194200g
TrEMBLV7AY980.0V7AY98_PHAVU; Two-component response regulator
STRINGXP_007138266.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-135response regulator 12