PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G186900.1
Common NamePHAVU_009G186900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 215aa    MW: 25154.7 Da    PI: 8.8589
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G186900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.87.1e-2682130452
              RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +s +++s+yF++pi +AAkeL+v+lT LK++CR++GI+RWPhRk+ sl
  Phvul.009G186900.1  82 MLSRKTVSQYFYMPISQAAKELNVGLTHLKKRCRELGIQRWPHRKLMSL 130
                         58999*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.65566151IPR003035RWP-RK domain
PfamPF020427.4E-2283130IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MNCYYPHDIL FETFPLEPAP LSFHDYDFSD VKNVLSAWKE VDCSDHKPAF SSSNDGESVN  60
AMREEMKGKH RREERISNSA RMLSRKTVSQ YFYMPISQAA KELNVGLTHL KKRCRELGIQ  120
RWPHRKLMSL QTLIRNMQEQ GQGEGPQNDE KIRTAIEMLE KEKSLVEERP DLELEDKTRR  180
LRQACFKANY KKRKLMGMRF MEPQSSLDGL SDKY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G186900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-128AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138178.11e-161hypothetical protein PHAVU_009G186900g
TrEMBLV7AX131e-160V7AX13_PHAVU; Uncharacterized protein
STRINGXP_007138178.11e-160(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-54RWP-RK domain-containing protein