PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G160900.1
Common NamePHAVU_009G160900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LFY
Protein Properties Length: 405aa    MW: 45618.3 Da    PI: 6.4368
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G160900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY648.97.2e-19813901386
             FLO_LFY   1 mdpeafsaslfkwdpraaa....aapp...arlleeaavseap...leaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdm 81 
                         mdp+af+aslfkwdpr++        p     ll + av+++p   + + a aa r+l +leelf+ayG+ry+t+akiaelGftvstLvdm
  Phvul.009G160900.1   1 MDPDAFTASLFKWDPRTVLpaapP--PrppPPLL-DYAVAPPPvapAYHLARAAPRELGGLEELFQAYGIRYYTAAKIAELGFTVSTLVDM 88 
                         9***************99865331..24323343.444444443324444555556688******************************** PP

             FLO_LFY  82 kdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeet..aldalsqeglseepvqe.ekeaagsggeglg 169
                         kdeeldd+m+sls+ifr+dllvGeryGikaavraerrr++++e +++  +lls+d++t  aldalsqeglseepv + ekea+gsgg++  
  Phvul.009G160900.1  89 KDEELDDMMNSLSQIFRWDLLVGERYGIKAAVRAERRRIDDDEIKRRNSNLLSTDTTTtnALDALSQEGLSEEPVVQrEKEAVGSGGGS-- 177
                         *******************************************999999999998876669*************999677788888877.. PP

             FLO_LFY 170 eaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCr 260
                         ++e+vaaee++++++++++   + k + ++e+++ + edee ee+e++++++ +g erqrehPfivtepgevargkknGLDYLf+LyeqCr
  Phvul.009G160900.1 178 TWEVVAAEERRKQQRRRRT---RMKANLQQEENE-DVEDEEGEENEEGNNNSGGGCERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCR 264
                         9****99965554444444...333333333222.233444455555566666789*********************************** PP

             FLO_LFY 261 efLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarq 351
                         efL+qvq+iak+rGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLde+ sn+lrrafkergenvGawrqacykplvaiaarq
  Phvul.009G160900.1 265 EFLMQVQAIAKDRGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEDVSNELRRAFKERGENVGAWRQACYKPLVAIAARQ 355
                         ******************************************************************************************* PP

             FLO_LFY 352 gwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                         gwdida+fnahprLsiWYvPtkLrqLCh+er++a+
  Phvul.009G160900.1 356 GWDIDAIFNAHPRLSIWYVPTKLRQLCHAERNSAA 390
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.9E-2101390IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MDPDAFTASL FKWDPRTVLP AAPPPRPPPP LLDYAVAPPP VAPAYHLARA APRELGGLEE  60
LFQAYGIRYY TAAKIAELGF TVSTLVDMKD EELDDMMNSL SQIFRWDLLV GERYGIKAAV  120
RAERRRIDDD EIKRRNSNLL STDTTTTNAL DALSQEGLSE EPVVQREKEA VGSGGGSTWE  180
VVAAEERRKQ QRRRRTRMKA NLQQEENEDV EDEEGEENEE GNNNSGGGCE RQREHPFIVT  240
EPGEVARGKK NGLDYLFHLY EQCREFLMQV QAIAKDRGEK CPTKVTNQVF RYAKKAGASY  300
INKPKMRHYV HCYALHCLDE DVSNELRRAF KERGENVGAW RQACYKPLVA IAARQGWDID  360
AIFNAHPRLS IWYVPTKLRQ LCHAERNSAA ASSSVSVGSA HLPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1112283992173PROTEIN LEAFY
2vy2_A1e-1112283992173PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G160900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4488100.0DQ448810.1 Glycine max LEAFY-like protein (LFY) mRNA, LFY-1 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007137848.10.0hypothetical protein PHAVU_009G160900g
SwissprotO485590.0UNI_PEA; Protein UNIFOLIATA
TrEMBLV7AW200.0V7AW20_PHAVU; Uncharacterized protein
STRINGXP_007137848.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80333346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-144floral meristem identity control protein LEAFY (LFY)