PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G115800.1
Common NamePHAVU_009G115800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 823aa    MW: 90821.1 Da    PI: 6.0665
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G115800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.31.5e-28511562152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Phvul.009G115800.1 511 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 562
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.223501582IPR003035RWP-RK domain
PfamPF020423.9E-24515562IPR003035RWP-RK domain
SuperFamilySSF542772.13E-23714808No hitNo description
Gene3DG3DSA:3.10.20.2401.6E-22722803No hitNo description
SMARTSM006661.7E-25723806IPR000270PB1 domain
PROSITE profilePS5174524.228723806IPR000270PB1 domain
PfamPF005647.2E-16724805IPR000270PB1 domain
CDDcd064073.18E-40724805No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 823 aa     Download sequence    Send to blast
MEYGALVQNG ACGSFSDIFA PETDFMDELF AEGCWVETRV GCGGSYLNCG TEPSKSNSCM  60
EIIFEEESEA ESLMVGKRWW IGPRANNPGP SSSVKERLVV AVGYLKEYAK NSNMVIQVWV  120
PARRGCAVGI HQDSYTTLDY TNITNNNNGD ATRVFQFQEE WLSDHWTPNI RFLRTHDYSR  180
VQQYDLRAGS LSLPVFQRGS GICLGVVEIL LPNNVNPDLH NLQGVDFRSY SLQNFIPPAM  240
TVKGFDELYQ GALNEIVEVL TCVCKAHELP LALTWAPCIQ QGKSGCGHSN EENYVSTVDP  300
ASFVADVDVL GFLDACSEYH LLGGQGVVGT AFTTAKPCFA NDITAFTKAE YPLAHYANMF  360
GLHAAVAIPL RSVSADFVLE FFLPKDCHDT QDQKQMLNSL SMLVQQACRS LHVVMDKEEE  420
EELVVHHHHH PHDSKEMESS SWIAHMMEAQ QKGKGVSVSL EYLQEPKQEF KVTTNCSEQV  480
FSELEGTGSV GVGVGGRRGG RKSGDKRRTK AEKTISLPVL RQYFAGSLKD AAKSIGVCPT  540
TLKRICRQHG ITRWPSRKIK KVGHSLRKLQ LVIDSVQGAE GSIQIGSFYT SFPELSSANG  600
VSESTKINND NSKFYSENGL LSNQGVTTTT STSPFKSPTS SCSQTCNPTS NQSTAIINNN  660
NNNDDIILMS ENQSLIGAPI QVQGEARHFT HHPPIPISIP IQSLDALPPL PQTNSVWNTG  720
SGSFRVKATF GDEKIRFSLQ PNWGFRDLQM EIARRFNLNE ISNSQLKYLD DAQEWVLLTC  780
DADLEECKDI NRSSQSRTVR LFLFHASPLS HSTNAFGGTS PT*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G115800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007137300.10.0hypothetical protein PHAVU_009G115800g
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLV7AUP50.0V7AUP5_PHAVU; Uncharacterized protein
STRINGXP_007137300.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein