PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G088900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ARR-B
Protein Properties Length: 456aa    MW: 50526 Da    PI: 9.0163
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G088900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.51.5e-28204257155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Phvul.009G088900.1 204 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 257
                         79*******************.********************************8 PP

2Response_reg80.65.2e-27201281109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ +++l+++l+k +y +v+++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ + 
  Phvul.009G088900.1  20 VLAVDDNPICLMVLENLLRKCQY-HVTTTNQAITALTLLREHKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKLVMKG 108
                         799********************.***************999999*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l Kp+ +eel +
  Phvul.009G088900.1 109 ISHGACDYLLKPVRMEELKN 128
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.1E-1671427IPR017053Response regulator B-type, plant
SuperFamilySSF521721.07E-3617141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.7E-4317141No hitNo description
SMARTSM004482.0E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.56919134IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.8E-2420128IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.69E-2821134No hitNo description
Gene3DG3DSA:1.10.10.601.4E-30201262IPR009057Homeodomain-like
PROSITE profilePS5129412.118201260IPR017930Myb domain
SuperFamilySSF466893.14E-20202261IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-25204257IPR006447Myb domain, plants
PfamPF002497.1E-7206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MTVEKRMGDS GEEFPVGMRV LAVDDNPICL MVLENLLRKC QYHVTTTNQA ITALTLLREH  60
KDKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTKLVMKGIS HGACDYLLKP  120
VRMEELKNIW QHVIRRKKFD SKEKNQTCNL DKPTSDSGNG HGSSGAVNSD QNEKLTKKRK  180
DQDEDEDEEQ ENDHDNEDPS SQKKPRVVWS VELHRKFVAA VNQLGIDKAV PKKILDLMNV  240
EKLTRENVAS HLQKYRLYLK RISCVANQQA NMVAALGGAD PSYLRMSSVS GVGHLQTLSG  300
SGQLHNNGFR SFPTGGIINR LNTPAGLNVH GFPSGVLQLS QSQNLSNTNN DHLKFRSAMA  360
PVNQNGVQGM PMPVQNNKSV ISVQNLTAVF NAKTNFPISN KLPEPRPKIT SVPRTSDVGI  420
ANNALMVFMK CFCISFNILT TRSAHMLKGF KVLTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-26200263164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G088900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136967.10.0hypothetical protein PHAVU_009G0889000g, partial
SwissprotB8AEH11e-142ORR23_ORYSI; Two-component response regulator ORR23
SwissprotQ6K8X61e-142ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLV7AXK20.0V7AXK2_PHAVU; Uncharacterized protein (Fragment)
STRINGXP_007136967.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-129response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]