PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G080800.1
Common NamePHAVU_009G080800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 557aa    MW: 62792.2 Da    PI: 4.5573
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G080800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK48.91.3e-15455503452
              RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         +++++dls +F+l+i+dAA +L+v+ +v+K+i R  ++kRWP+Rk++sl
  Phvul.009G080800.1 455 KMTMNDLSPFFHLTIRDAADKLDVSDSVVKKISRLGNLKRWPQRKLQSL 503
                         689*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.333443524IPR003035RWP-RK domain
PfamPF020423.1E-15455503IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MDNNWNNSSD LFDNSPLISN YIEPDPALVY IFNDQPNVLP QQRNAEQNDP FVVEQDHVSF  60
TGLTIEDVST HSDNDITTGG VSKLDQGGWS MRKRKFSFMD SMIEDHPMHD KDNFPNGENM  120
SAHINLNQLR VWPPAPFDID IDTSFDPFLH NLIDRDISIF DLSNDELVSP SLQQNALPQH  180
QQQVPQNALS KQQNALPQLL HTLPQSQNVY QFGVEQIHVP ILNPTFQEQS LHVNCNFTTG  240
GEVPNIDVGN QSMAEHPLLR HGILNEEDVI AIDHWPSSSK LLSCSCCQIL RQIIHTDGFK  300
FEKLEIHGSL GVIGHAIFHI QDMTPGGEPP REIYQMIDLC GKSIEQIRSF LAAYCKDQTR  360
LGLVTLDDPL SSYYDTICTG LDWVEHYNDG DDDLSPPNST EPESDSEPEP EPEPEPEPET  420
IPESDPVPEP HNGEASTTKP KPKRNMAVQR KRVPKMTMND LSPFFHLTIR DAADKLDVSD  480
SVVKKISRLG NLKRWPQRKL QSLAKDVRVL RKALNSPYEG TSKRVRQEIQ RLQREMVAVC  540
GGVAPTGIEM LQLEEE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G080800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150359e-88AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136870.10.0hypothetical protein PHAVU_009G080800g
TrEMBLV7ATG70.0V7ATG7_PHAVU; Uncharacterized protein
STRINGXP_007136870.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-06RWP-RK domain-containing protein