PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G075300.1
Common NamePHAVU_009G0753001g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 243aa    MW: 27997.9 Da    PI: 8.9303
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G075300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.8e-19128182256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +k+ ++tkeq  +Le+ F+++++++ ++++eLAkkl+L  rqV vWFqNrRa+ k
  Phvul.009G075300.1 128 KKKLRLTKEQSAVLEDSFKEHSTLTLTHKQELAKKLNLRARQVEVWFQNRRARNK 182
                         788899***********************************************98 PP

2HD-ZIP_I/II1101.6e-35128216190
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                         +kk+rl+keq+++LE+sF+e+++L+ ++K+ela++L+l++rqv+vWFqnrRAR k+kq+E+++e Lk+++++l+een+ L+ke eeL+ +
  Phvul.009G075300.1 128 KKKLRLTKEQSAVLEDSFKEHSTLTLTHKQELAKKLNLRARQVEVWFQNRRARNKLKQTEVNCELLKKCCKSLTEENKILQKELEELK-S 216
                         59*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-17122185IPR009057Homeodomain-like
PROSITE profilePS5007116.552124184IPR001356Homeobox domain
SMARTSM003899.9E-15126188IPR001356Homeobox domain
CDDcd000861.06E-13128185No hitNo description
Gene3DG3DSA:1.10.10.601.0E-17128182IPR009057Homeodomain-like
PfamPF000467.4E-17128182IPR001356Homeobox domain
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
PfamPF021835.9E-7184218IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.5E-16184227IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MLFDISNPCL RLGLGLQDQS QETCMKSHEQ RQKKKEADPR NRAHPSLRLR PPHDDANNNH  60
QVTKTDSDEY FNFHPHASPA SAVSSFFNSS SFIKRERDQL AGQELELEVE KFPSNLRVVD  120
LDEYGCSKKK LRLTKEQSAV LEDSFKEHST LTLTHKQELA KKLNLRARQV EVWFQNRRAR  180
NKLKQTEVNC ELLKKCCKSL TEENKILQKE LEELKSMKTA LQGPIFMQLP VATLRICPSS  240
YC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126132SKKKLRL
2176184RRARNKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G075300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150353e-95AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136800.11e-177hypothetical protein PHAVU_009G0753001g, partial
SwissprotP466654e-49HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLV7AT971e-175V7AT97_PHAVU; Uncharacterized protein (Fragment)
STRINGXP_007136800.11e-176(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-50homeobox from Arabidopsis thaliana