PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G061700.1
Common NamePHAVU_009G061700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 325aa    MW: 35832.4 Da    PI: 8.4863
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G061700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.6e-31141194255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv++v+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Phvul.009G061700.1 141 PRMRWTTTLHAHFVHVVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 194
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-27138195IPR009057Homeodomain-like
SuperFamilySSF466895.38E-15138195IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-22141194IPR006447Myb domain, plants
PfamPF002495.2E-7142193IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MCTSPHAVMP TFAPMPEPDL SLNISPPFTS DPDAKQVETT CTGLTLTTKT LYTDLCSTSD  60
SGSSGSDLSN ENGFSNTLYN LGHREPTLSL GFGRENLNPY RIQGAVLRNF NHHNNQPQTN  120
TFDFKRNARG IPGVKRSSRA PRMRWTTTLH AHFVHVVQLL GGHERATPKS VLELMNVKDL  180
TLAHVKSHLQ MYRTVKSSDK SSAGYGQTGI GLSQKPGIVD LHGALACERP NLPQPLLKFH  240
RAPWQSSMET NSINYTQNPI INSMYSHLKG NQTMVGGQHY GGLSNCMEEK LESCSLSRSD  300
MTLDLEFTLG RPTTCKEITQ KQEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16142196357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16142196357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16142196357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16142196357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates carpel integuments formation. Required for the specification of polarity in the ovule inner integument. Modulates the content of flavonols and proanthocyanidin in seeds. {ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:19054366, ECO:0000269|PubMed:20444210}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G061700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-179AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136645.10.0hypothetical protein PHAVU_009G061700g
SwissprotQ9FJV59e-48KAN4_ARATH; Probable transcription factor KAN4
TrEMBLV7ASU20.0V7ASU2_PHAVU; Uncharacterized protein
STRINGXP_007136645.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.16e-50G2-like family protein
Publications ? help Back to Top
  1. Lora J,Hormaza JI,Herrero M
    Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
    New Phytol., 2015. 208(2): p. 584-95
    [PMID:25991552]
  2. Skinner DJ,Brown RH,Kuzoff RK,Gasser CS
    Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function.
    BMC Plant Biol., 2016. 16(1): p. 143
    [PMID:27350128]
  3. Gomez MD,Ventimilla D,Sacristan R,Perez-Amador MA
    Gibberellins Regulate Ovule Integument Development by Interfering with the Transcription Factor ATS.
    Plant Physiol., 2016. 172(4): p. 2403-2415
    [PMID:27794102]