PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G051600.1
Common NamePHAVU_009G051600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 270aa    MW: 30656.4 Da    PI: 8.1232
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G051600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.53.7e-25160207552
              RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         +++e+++k+F+ pi++AAk+++v+lT+LKr+CR+++I+RWPhRk+ksl
  Phvul.009G051600.1 160 LEFEEIKKHFDVPINEAAKQMNVGLTMLKRRCRELNIMRWPHRKLKSL 207
                         89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.972142228IPR003035RWP-RK domain
PfamPF020422.3E-23160207IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MDFVSERDFP NLEIIPHTFN SCFFSAQLYP TDKTMEVSLS PLEGFSDHDW TQQLSYSSKQ  60
LSLNEFPDLE NLDIDFSLPP LGEDLEEVDQ KPLNIIVVPE NGRCSREKGF GDALLAIESG  120
SAICVKKEEV QNIEQMLVPR ARGRGSGSSG SSKKKKPCAL EFEEIKKHFD VPINEAAKQM  180
NVGLTMLKRR CRELNIMRWP HRKLKSLQLL IDNVKELGLA EEVSMLEKHK RLLEKLPGLE  240
ISAKAKKLRQ ACFKANYKRR RYMGMAVQA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G051600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-118AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136514.10.0hypothetical protein PHAVU_009G051600g
TrEMBLV7AV810.0V7AV81_PHAVU; Uncharacterized protein
STRINGXP_007136514.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-41RWP-RK domain-containing protein