PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G047000.1
Common NamePHAVU_009G047000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family GRF
Protein Properties Length: 595aa    MW: 63726 Da    PI: 8.4155
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G047000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.46.8e-25203246144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Phvul.009G047000.1 203 DPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVE 246
                         79***************************************998 PP

2QLQ53.48e-19138168232
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32 
                         +FT aQ+ +L++Q+++yKy++a++PvPp+Ll
  Phvul.009G047000.1 138 PFTSAQWRELERQAMIYKYMMASVPVPPDLL 168
                         8*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.9E-10137173IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.788138173IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-13138168IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.739203247IPR014977WRC domain
PfamPF088792.1E-20204246IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MGEFGLSHTR KRSSSSNNSG GSVVGLDVKL QSPEALFHNK MTMMAHHNHH HRPLSSPFDN  60
DSCAGDGDGP TAYMSFTNHI NLVSGASVLA PAIDGGCGAP APVRTLQPFD ISPYTSPTTT  120
SSTFKPSAGG MAASLGFPFT SAQWRELERQ AMIYKYMMAS VPVPPDLLIH TSLTSSSRSV  180
CSMNDPLLSL DGGFNLRLAS STDPEPGRCR RTDGKKWRCS RDVAPNHKYC ERHMHRGRPR  240
SRKPVEVNTK TTTPTSINNN SHQIKRPRHE SNPFPSIPDV TVAISNPTSR KHGSSPHFLG  300
SSTTPPYLES PLSLANFSLK AANFDSMASV SANKEPRGLE WMLNGDPISL GASDSEWQSL  360
MHNKVGLSSE SCCNNTQPQF LNSFALYNTG LDQQNRRHPF LNPLIVPMEN LQPEKTRGFI  420
DAWSNTETGE NNAATTNNNN KNSAVSIGKL SLSSLDLSKG GGAVNEDLGN VNIGLGLMES  480
IANTHTDTKI SLSNWLNPAP WVASTLGGPL AEVLRSSTVT ATTKTNEATS NTPSPATTHV  540
ESNSPLGTMV SSPSGVLQKT LVSLSDSSSN SSPTVASSRA NSEMTLLRFQ PNVN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G047000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136458.10.0hypothetical protein PHAVU_009G047000g
TrEMBLV7AS180.0V7AS18_PHAVU; Uncharacterized protein
STRINGXP_007136458.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-34growth-regulating factor 7