PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G011200.1
Common NamePHAVU_009G011200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 915aa    MW: 101503 Da    PI: 6.0331
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G011200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.8e-29599650152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Phvul.009G011200.1 599 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 650
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.803589670IPR003035RWP-RK domain
PfamPF020426.5E-25602650IPR003035RWP-RK domain
SuperFamilySSF542773.43E-23819905No hitNo description
PROSITE profilePS5174525.11820903IPR000270PB1 domain
SMARTSM006664.9E-22820903IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.9E-22820900No hitNo description
PfamPF005641.3E-18821901IPR000270PB1 domain
CDDcd064071.10E-41821901No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 915 aa     Download sequence    Send to blast
MMRDGDVTSS SATMMEASPP DGTTTSMDFD YMGELFYDGC WFEASVDGSD FLLQSPSYSN  60
PLFDPSFSWP ALETNHNESQ GAAFGTQEEG HNNNVVAARG GGGGGQQFQP ETISIEGASD  120
GVRRWRFAPT PSPAPGPSIM EKLVRALMRI KDYNRNKNML IQIWVPVHRG GRPILAANDI  180
LFSLDSRSMN LAKYREISVR YEFSAEEGEV KELVPAEEGD SKELVLGLPG RVFRDKVPEW  240
TPDVRFFRSD EYPRLDHAQE YDVSGSLAVP IFEQGSKMCL GVIEVVMTTQ QINYGPELES  300
VCKALEAVDL RSSKQLSIQN VKACNRSYEA VLPEIQQVLR SACEMHKLPL AQTWIPCVQQ  360
GKEGCRHSED NYLFCISPAE HACYVGDPKI RSFHESCTEH HLLKGEGVAG GAFMTNQPCF  420
SDDITSLSKK DYPLSHHARL FGLRAAVAIR LRSIYNSTDD FVLEFFLPVD CNDSEEQRKM  480
LTSLSIIIQR VCRSLRVISD KELVEAKLSI DEGISLADSG FDRTAICEEL QHKGTVASLD  540
TEEKLSETTG RKFSDPMRQQ KSPILKGNLD CVRESSTSVE GNLSSVGMSK MGDRRRAKAE  600
KTITLQVLRQ YFAGSLKDAA KNIGVCTTTL KRICRQHGIK RWPSRKIKKV GHSLQKLQLV  660
IDSVQGASGA FQIDSFYSNF PDLASPNLSG TTLFSTFNQT DNPNSISTQP DPGALSPEGT  720
SKSPSSSCGQ SSISSHSYSS MSELQQLHTT NIAGKKDSTT AGEDSAVVAL KRIRSEAELK  780
SLNQDKAKLL PRSLSQETLG EHPKNQYQRP LLKTSSKVDA HRVKVTYGDE KTRFRMPKNW  840
GYEDLLQEIG GRFNVSDMKK FDVKYLDDDC EWVLLTCDAD LEECIDVCQS SESGTIKLSL  900
QTSTHSMRSS LEFR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.009G011200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136019.10.0hypothetical protein PHAVU_009G011200g
TrEMBLV7ATS80.0V7ATS8_PHAVU; Uncharacterized protein
STRINGXP_007136019.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein