PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G003800.1
Common NamePHAVU_009G003800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family GATA
Protein Properties Length: 301aa    MW: 33031.1 Da    PI: 6.9493
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G003800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA572.6e-18217250134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Phvul.009G003800.1 217 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 250
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.0E-7815299IPR016679Transcription factor, GATA, plant
SuperFamilySSF577161.9E-13211272No hitNo description
PROSITE profilePS5011411.411211247IPR000679Zinc finger, GATA-type
SMARTSM004011.7E-12211265IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.5E-14215248IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.69E-13216273No hitNo description
PROSITE patternPS003440217242IPR000679Zinc finger, GATA-type
PfamPF003203.6E-16217250IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MEVAVAKALK PSLMGEFIVQ QTNCEDFFCL NANTVVGGDD FFVDDLFDFS DGSLHYEQQD  60
CVEEKKSLSA SSQSKDQGED DSNSNSTGAS YDSLFSAELA VPAGDLEDLE WVSHFVDDSL  120
PELSLLYPVR SEEVNRRVEP EPSAKKTPRF PCEMKITTKA RTVRNRKPNA RVWSLGPLLS  180
LPSSPSSCSS SVTEPPAKKQ KKRAEAQPVG AQVQRRCSHC QVQKTPQWRT GPLGAKTLCN  240
ACGVRYKSGR LFSEYRPACS PTFCSDIHSN SHRKVLEIRK KKEVAGPDTG SAQAQMVPTC  300
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135927.10.0hypothetical protein PHAVU_009G003800g
TrEMBLV7AUM40.0V7AUM4_PHAVU; Uncharacterized protein
STRINGGLYMA06G01110.11e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.15e-48GATA transcription factor 7