PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G291800.2
Common NamePHAVU_008G291800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 726aa    MW: 80526.4 Da    PI: 6.5362
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G291800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.51.3e-28508559152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Phvul.008G291800.2 508 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 559
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1014473.92E-5385395No hitNo description
PROSITE profilePS5151917.416498579IPR003035RWP-RK domain
PfamPF020423.3E-24512559IPR003035RWP-RK domain
SuperFamilySSF542771.44E-20633723No hitNo description
Gene3DG3DSA:3.10.20.2404.0E-19638719No hitNo description
PROSITE profilePS5174518.361638721IPR000270PB1 domain
SMARTSM006669.5E-21638721IPR000270PB1 domain
PfamPF005641.2E-12639720IPR000270PB1 domain
CDDcd064078.96E-37639720No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MEYGGGFGSL WECGSAWEED SIEEVLVEGC WVEASGVGSC EGEYMGSSEA EMEMEVMRKR  60
WWIGPEANSS VKERLVVAVG YIRECTKNSN VVIQVWVPLR SGLVGGPGNN LRRNHPDEWV  120
SVEMNMNMNM NMNSARDVSL RFYRSHEYPR VPYYVDVPGS LALPVLERGT HTCLGVILIL  180
MPPCDTINYC PQVLNNSLLC NSSFQVFEEV YEAAVNEMAE VMKCVCRAQN VALALTWAPC  240
CIQQGGKCGY GHSTETHFST VERACFVGEA QALPFKEACS QHHLLRGQGI VGTAFTTSKP  300
CFAVDIAAFS RAQYPLAHHA NIFGLHAAVA IPLRTLYADF VVEFFLPKDC HDREHQNHFL  360
NSISLLLQQS CRNLHVVMGD EFTLPPPPPP PPPPPQQYLS NKEEMVVSEK LESQWQAEAC  420
GSWIAHMMEA QAQEQKGKGV CVSLEYLEEA KEEFKVTGKC RWESGGGGAY EAADLHEQQV  480
FGDESQTQTQ SFGGRRGRKS GEKRRTKAEK TISLPVLRQY FAGSLKDAAK SIGVCPTTLK  540
RICRQHGITR WPSRKIKKVG HSLKKLQLVI DSVQGAEGAI KIGSFYNSFP ELSSATSHSS  600
IPNNSSSFYG HSPPSSSSPS TAPPQHQHFS QTSCTAAPLR VKASFGDEKI RFSLQPKWGF  660
RELEVEIGRR FNVKDLGKVV VKYLDDEGEW VVLACDGDLE ECKDLHTTYE SRTIRLALFQ  720
PSSSP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G291800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142568.10.0hypothetical protein PHAVU_008G291800g
RefseqXP_007142569.10.0hypothetical protein PHAVU_008G291800g
TrEMBLV7B9K90.0V7B9K9_PHAVU; Uncharacterized protein
STRINGXP_007142568.10.0(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-126Nin-like family protein